Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-3 IGR731 IGR732 IGR729 IGR734 IGR730 IGR733 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP0995 TP0999 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP0995 TP0999 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP0995 TP0999
* Calculated from Protein Sequence

Gene ID: TP0998

DNA Molecule Name:
1  

Genbank ID:
3323324

Gene Name:


Definition:
amino acid transporter/ probable sodium,proton-dependent alanine transporter

Gene Start:
1085975

Gene Stop:
1084476

Gene Length:
1500

Molecular Weight*:
53828

pI*:
9.89

Net Charge*:
15.68

EC:
 

Functional Class:
Transport and binding proteins; Amino acids, peptides and amines  

Pathway: pathway table

Comment:
This protein may have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to amino acid transporters
and sodium/proton-dependent alanine transporters. For example 56-485
are 42% similar to ALST_BACSU, amino acid carrier protein of Bacillus
subtilis,(Z99113). Residues 49-490 are 36% similar to a probable
sodium/proton-dependent alanine transporter of Bacillus subtilis,
(Z99105).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1115
COG name: Sodium-alanine symporters
Functional Class:  E
The phylogenetic pattern of COG1115 is ---k----eB-Huj---LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 97-147, 83-133, 220-271, 190-241, 297-348, 423-474, 299-330,
391-403, 390-402, 440-480, and 331-371 represent significant (100%)
hits to blocks BL00873A,B,C,D,E, Sodium:alanine symporter family proteins.
Residues 99-127, 58-92, 224-258, 50-79, 308-352, 377-430, and 230-283
represent significant (96%) hits to blocks BL00218A,B,C,E,F, Amino acid
permeases proteins.

ProDom Summary:  Protein Domain Search
Residues 96-478 are 48% similar to YAAJ_HAEIN, a hypothetical integral
membrane protein that belongs to the sodium/alanine symporter family.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 81 to 490 (E-value = 8.9e-144) place TP0998 in the Na_Ala_symp family which is described as Sodium:alanine symporter family (PF01235)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
56
transmembrane  
60  
80
transmembrane  
108  
126
transmembrane  
130  
148
transmembrane  
179  
208
transmembrane  
218  
244
transmembrane  
248  
274
transmembrane  
282  
301
transmembrane  
327  
359
transmembrane  
381  
403
transmembrane  
420  
442
transmembrane  
446  
468

PDB Hit:
none

Gene Protein Sequence:
MRGGNRRDPISCNGKMLCVTLDGRALXLFYPLKLEGISMTAFQALLIRLV
DALHSYILVGWLVVCGVFFTIKTGCVQLSLLKPAFAALAEKRGKGVSSFQ
ALMISTASRVGAGNIVGVATAIAFGGKGAVFWMWVSAFFGAASAFVESTL
AQAYKTRTACGFRGGPAYYIEMGLKSRSMGVLFALCLVFAYAYGFNALQA
YNIVSTLSYYGKDSSLWVQILAVLLSFLLAFVIFGGVARISVVSSVIVPV
MAVGYVFLGLWVLALNVYRLPALFFEICREGLSLTAFAGGTFGSVVVIGI
KRGLLSHEAGMGSAPNAAASAEVSHPVVQGLVQALSVFIDTMLICSVTAF
VLLLSDVAGSVDVSGMQFVQQALSKQVGPVGVHLVTLAIFLFAFSSLMGN
YYYAESNVRFIKDHKMVLSVFRVTCVSAVFVGAHASFHFVWGVADLFMVF
MTVINLIAIVTLHPVALYLLRDYRKQYRAGNVPVFFQEHLVFPEKMACRE


Gene Nucleotide Sequence:  Sequence Viewer
GTGAGGGGAGGAAACAGGCGCGACCCAATATCTTGTAACGGTAAGATGCT
TTGCGTTACACTGGACGGGCGTGCTTTGNGCCTATTTTACCCATTGAAGT
TGGAAGGAATTTCCATGACCGCGTTTCAGGCGCTGCTTATCCGCCTTGTC
GATGCTTTGCACTCCTATATCCTCGTCGGGTGGCTTGTCGTCTGCGGTGT
CTTTTTTACCATAAAGACTGGCTGTGTTCAACTTAGTCTTCTGAAGCCTG
CGTTTGCAGCGCTGGCTGAAAAGAGGGGGAAAGGAGTTTCATCATTTCAA
GCGCTTATGATTTCCACTGCGAGCCGTGTGGGGGCTGGGAACATTGTCGG
CGTTGCTACGGCTATCGCCTTTGGAGGAAAAGGGGCAGTGTTTTGGATGT
GGGTGAGTGCCTTTTTTGGCGCTGCAAGTGCCTTTGTCGAAAGTACGCTC
GCCCAAGCATACAAAACGCGTACTGCGTGTGGTTTTCGAGGTGGTCCCGC
CTATTACATCGAAATGGGTCTGAAAAGTCGCTCCATGGGGGTGCTTTTTG
CGCTGTGTCTTGTCTTTGCATACGCGTACGGGTTCAATGCACTACAGGCT
TATAATATTGTCTCTACTCTCTCTTACTACGGAAAGGATTCTTCTCTGTG
GGTCCAGATCCTAGCGGTGTTGCTGTCTTTTCTCCTTGCGTTTGTTATCT
TTGGGGGGGTCGCGCGCATTAGTGTTGTCAGTTCGGTGATAGTACCAGTG
ATGGCTGTGGGTTATGTTTTCCTCGGGCTGTGGGTGTTGGCACTCAATGT
GTACAGGCTCCCTGCGCTCTTTTTTGAAATTTGCCGGGAAGGACTGAGCC
TCACGGCGTTTGCTGGTGGTACGTTCGGTTCGGTGGTGGTCATTGGAATA
AAGCGTGGCTTGCTGTCTCACGAGGCAGGAATGGGTTCGGCGCCTAACGC
TGCAGCTTCTGCAGAAGTGAGTCACCCGGTTGTGCAGGGCCTGGTGCAGG
CACTCTCGGTGTTTATAGACACGATGCTAATTTGTAGTGTGACTGCTTTT
GTGTTGCTGCTCTCTGATGTTGCAGGATCAGTGGATGTGAGCGGAATGCA
GTTCGTGCAGCAAGCGCTGTCCAAGCAAGTTGGCCCCGTGGGGGTGCACT
TGGTGACGCTTGCGATCTTTCTGTTTGCATTCAGTTCACTGATGGGTAAC
TATTACTACGCGGAGTCAAACGTACGTTTCATTAAGGACCATAAAATGGT
TTTGAGTGTTTTCAGAGTTACCTGTGTCAGTGCGGTATTTGTCGGTGCGC
ATGCGAGTTTTCATTTTGTTTGGGGTGTTGCGGATCTTTTTATGGTATTT
ATGACGGTCATCAACCTGATTGCTATCGTGACACTGCATCCGGTGGCGTT
GTATCTACTGCGTGACTATCGCAAGCAATATCGTGCTGGGAATGTGCCAG
TCTTCTTTCAGGAACATTTGGTATTTCCTGAAAAGATGGCCTGCCGGGAG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy