Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-3 IGR731 IGR732 IGR728 IGR729 IGR730 IGR733 IGR727 TP0998 TP0996 sppA, - TP0997 TP0994 TP0995 TP0999 TP0998 TP0996 sppA, - TP0997 TP0994 TP0995 TP0999 TP0998 TP0996 sppA, - TP0997 TP0994 TP0995 TP0999
* Calculated from Protein Sequence

Gene ID: TP0997

DNA Molecule Name:
1  

Genbank ID:
3323323

Gene Name:
sppA  

Definition:
protease IV

Gene Start:
1084439

Gene Stop:
1082646

Gene Length:
1794

Molecular Weight*:
66503

pI*:
9.82

Net Charge*:
9.12

EC:
3.4.-.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is involved in the digestion of cleaved signal peptides.
This activity is necessary to maintain proper secretion of mature
proteins across the membrane.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to protease IV proteins.
For example residues 88-558 are 32% similar to Proteinase IV of
Escherichia coli,(AE000271).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class:  N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 88-359 are 34% similar to protease IV of SPPA_ECOLI.
Residues 137-265, 390-527, and 458-538 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 131 to 293 (E-value = 8e-25) place TP0997 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)
Residues 384 to 537 (E-value = 1e-47) place TP0997 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
37
transmembrane  
397  
427
non-globular  
442  
558

PDB Hit:
none

Gene Protein Sequence:
MYSLRVLFRRLLRGLNAVRLVSLNVIFFLLLFLFFKVLVGDRSRRPSQKV
VQSGTVLLMRPVGVVTEQRPRVNLGTVFLNPKGSAILLSDITQALRNAAT
DRRIESVFFDLSNMSGWTSGHFVEMESALSEYKKSKKPLYVFSTSYSLAD
YYIASFADEIILDPMGSVDLSGFYTETLFYXGMEEKIGVRWNXVHAGVYK
GMAEIFSRKDFSPEVRRNYQSVFARLWQQYLSDVSRNRALEVQHLARYAD
RRLELLQKYNGDGARTALAEKLVTRVCSYDEAGVALKFLKEDDYESAKNF
VGLDDYNRDRAQRQVQDQVGIIHLAGPIAAHRDTELGGTISDEVSALLDV
AMSDPDIKAVVLRIDSGGGEVFASERIRRALARAKRRGKKPVIVSMGAIA
ASGAYWVASAADYIFASPYTITGSIGVLSVLPTFETFLERYAGITVDSVQ
VHGVRQPSLLRSGTAEDTARMQLDVMATYRTFLSVVSAGRNLTLDRVAAV
AEGRIYAGEDAVSLGLVDALGGLDEAVAHAAKESHCRQYSVRVLKRSATY
GEEFLQSLWDVLQKRSLAFGERVIIGELLQLDLSKGTYVYEPLRLHWR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACTCATTGAGAGTTCTCTTTAGGAGGCTGCTTCGTGGGTTAAATGC
CGTTCGGTTGGTCAGTTTGAACGTCATTTTCTTTCTTTTGTTGTTCTTGT
TTTTCAAAGTGCTAGTTGGTGACCGTAGCCGAAGGCCGTCTCAGAAGGTG
GTACAATCTGGGACCGTGTTGCTGATGAGACCGGTTGGCGTTGTTACTGA
GCAACGGCCGCGTGTTAATTTGGGCACCGTGTTCTTGAACCCAAAGGGAT
CGGCGATCCTTCTTTCTGATATTACCCAGGCGCTGCGCAACGCAGCCACC
GATCGACGCATTGAGTCCGTTTTTTTCGATCTGTCCAATATGAGTGGTTG
GACGAGCGGACATTTTGTGGAAATGGAATCCGCTCTGTCTGAGTATAAAA
AGTCAAAAAAGCCGCTCTACGTTTTTTCTACCTCTTACAGTTTGGCTGAC
TATTACATCGCCTCTTTTGCTGATGAAATTATCCTTGATCCGATGGGGTC
TGTGGATCTGTCGGGCTTTTACACGGAAACTCTCTTTTACGNAGGTATGG
AGGAAAAGATTGGGGTGCGTTGGAACGYCGTGCATGCTGGGGTGTACAAG
GGCATGGCTGAGATCTTTTCTAGGAAGGATTTTTCTCCTGAGGTTCGCAG
AAATTATCAGTCTGTATTTGCGCGTCTGTGGCAGCAGTATCTCAGTGATG
TTTCGCGTAATCGAGCACTAGAGGTGCAGCATCTTGCCCGTTACGCGGAT
CGTCGCCTTGAGCTCCTGCAGAAGTATAACGGAGACGGTGCGCGCACCGC
ATTGGCGGAAAAGTTAGTAACGCGCGTATGTTCCTACGATGAAGCTGGCG
TTGCGCTCAAATTTTTAAAAGAAGACGACTACGAATCTGCAAAAAATTTC
GTTGGTCTAGACGATTATAATCGTGACCGTGCACAGCGGCAGGTGCAGGA
TCAGGTGGGGATTATTCATCTTGCAGGACCGATTGCTGCACACAGGGATA
CGGAACTCGGCGGAACGATCAGCGACGAGGTTAGTGCTTTGTTGGATGTC
GCGATGAGTGATCCGGATATTAAGGCAGTAGTGTTGCGTATTGATTCCGG
TGGGGGAGAGGTGTTTGCTTCTGAACGTATCCGCCGCGCGCTTGCGCGGG
CAAAGCGTCGAGGCAAGAAGCCAGTGATAGTATCGATGGGTGCGATTGCT
GCGTCTGGTGCGTACTGGGTTGCTTCTGCAGCCGATTACATCTTCGCATC
CCCCTATACCATCACTGGTTCCATAGGGGTGCTTTCGGTACTACCGACAT
TCGAAACGTTTTTAGAGCGATATGCGGGGATCACTGTCGATAGCGTACAG
GTGCACGGCGTTCGCCAACCTTCTTTGCTCAGGAGTGGAACGGCTGAAGA
CACCGCGCGCATGCAGCTTGATGTGATGGCGACGTATCGTACTTTTCTTT
CGGTTGTTTCTGCCGGGCGTAACCTTACCCTTGATCGGGTGGCGGCGGTT
GCAGAGGGTAGGATTTACGCGGGGGAGGACGCAGTTTCCCTAGGCTTGGT
TGATGCGCTAGGCGGACTAGATGAAGCGGTAGCACATGCAGCGAAAGAAT
CACATTGCAGGCAGTATTCGGTGAGAGTTTTGAAGCGGAGCGCCACGTAC
GGTGAAGAATTTCTGCAGTCCCTGTGGGATGTCCTGCAGAAACGAAGTCT
TGCTTTTGGAGAGCGTGTGATCATTGGAGAGTTACTCCAGCTTGACCTAA
GCAAGGGCACCTACGTATATGAGCCGCTGCGCTTGCATTGGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy