Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-3 tRNA-Leu-5 IGR725 IGR731 IGR724 IGR728 IGR729 IGR726 IGR730 IGR727 rlpA, - TP0993 TP0998 TP0996 sppA, - TP0997 rubR, - TP0991 TP0992 TP0994 TP0995 TP0990 rlpA, - TP0993 TP0998 TP0996 sppA, - TP0997 rubR, - TP0991 TP0992 TP0994 TP0995 TP0990 Type: tandem, Name:  - 220 Type: tandem, Name:  - 221 rlpA, - TP0993 TP0998 TP0996 sppA, - TP0997 TP0992 TP0994 TP0995 TP0990 rubR, - TP0991
* Calculated from Protein Sequence

Gene ID: TP0995

DNA Molecule Name:
1  

Genbank ID:
323321

Gene Name:


Definition:
hypothetical protein/ possible cyclic nucleotide binding protein

Gene Start:
1079501

Gene Stop:
1080784

Gene Length:
1284

Molecular Weight*:
48532

pI*:
6.59

Net Charge*:
-2.60

EC:
 

Functional Class:
Hypothetical  
Regulatory functions  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the C-terminal region had only one significant
hit in the database. Residues 323-415 are 35% similar to cAMP
protein kinase regulatory chain of Synechocystis sp.,(D90917).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0664
COG name: cAMP-binding domains - Catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases
Functional Class:  T
The phylogenetic pattern of COG0664 is a---YQvCEbRH-----Lin-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 322-345 represent a significant (95%) hit to block BL00888,
Cyclic nucleotide-binding domain proteins.

ProDom Summary:  Protein Domain Search
Residues 304-400 are 25% similar to calicum gated channel of
CGCC_MOUSE, which has similarity in this region to cyclic
nucleotide binding proteins.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0089, cyclic nucleotide
binding protein and TP0262, catabolite gene activator/ cAMP receptor
protein. Residues 306-428 are 28% similar to TP0089 and residues
319-420 are 24% similar to TP0262.

Pfam Summary:  Pfam Search
Residues 312 to 402 (E-value = 2.7e-16) place TP0995 in the cNMP_binding family which is described as Cyclic nucleotide-binding domain (PF00027)

PDB Hit:
none

Gene Protein Sequence:
MSMSKIPLISTVTSTISAINGACTGERVDIHIQTLSRLNEIASVFRFEMP
EIKIIDFGDPNVDSEACLKIIKDDPWLLFGGVIAITNSMEEKIKIVNRKD
PNFLSVSTRQEFEAHASQVVRIVDRNRHFLSSRSLVHQAHGHEQGNFICD
TDSFEITFYASLISSYLYNTNRINELERTSFEGAMMELLLNALEHGNCGI
SYDEKTEWLEQRKDIFDLIALRKQDPRISAKKIYISYDITLQRTRITIRD
EGTGFDWKSRMASACKPGLHGMGIKMTEIFVKRLSYNDVGNEVTFEIDNQ
ENVANLVPSILKNQQVLTFRDAQVVCYQNEESSSLFYISSGKFAVYVDNK
FMSMLTPSDIFIGEMSFLLNNRRSATIVSVGEGTLVKISKMKFISLIEDH
PHYGIYLARLLAGRLAHQSRESASLKTP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTATGAGCAAAATACCTCTTATCAGTACGGTTACGTCTACCATATC
TGCCATTAACGGTGCGTGTACTGGAGAACGCGTGGATATACACATTCAGA
CGCTCTCTCGTCTGAATGAGATAGCATCCGTTTTTCGCTTCGAGATGCCT
GAGATTAAGATTATTGATTTTGGTGACCCAAACGTCGACAGCGAAGCGTG
TTTAAAAATTATAAAGGATGATCCTTGGCTTCTATTTGGTGGGGTGATTG
CTATCACTAACTCGATGGAAGAAAAAATAAAAATCGTAAATCGCAAAGAC
CCGAATTTCCTTTCAGTTTCCACGCGGCAGGAATTTGAAGCGCATGCCTC
CCAGGTTGTGCGAATCGTGGACAGAAACCGACACTTTCTTTCTAGTCGCA
GCCTCGTGCACCAAGCACATGGACACGAGCAGGGAAATTTTATCTGCGAC
ACCGATTCCTTTGAGATTACCTTTTACGCCAGCTTGATTAGTTCGTACCT
GTACAATACCAACCGTATCAATGAGCTTGAACGCACTTCGTTTGAAGGCG
CAATGATGGAACTGTTACTCAATGCACTGGAGCACGGAAACTGCGGCATT
AGCTACGACGAAAAAACAGAGTGGCTCGAACAGCGCAAGGATATCTTTGA
TTTGATTGCTCTGCGCAAGCAGGACCCGCGCATTAGCGCGAAAAAAATCT
ATATTTCCTATGACATTACACTGCAGCGTACACGCATTACCATTCGTGAC
GAAGGCACAGGCTTTGATTGGAAAAGCCGCATGGCAAGCGCGTGCAAACC
TGGTCTACACGGTATGGGCATAAAAATGACAGAAATTTTTGTCAAAAGGC
TCAGCTATAACGACGTGGGCAACGAGGTGACGTTTGAAATTGACAACCAG
GAAAACGTCGCGAACCTTGTGCCTTCAATTTTGAAAAACCAACAGGTACT
AACGTTCCGGGATGCCCAGGTGGTATGTTACCAGAACGAAGAATCCAGTT
CCCTTTTCTACATTTCGTCGGGGAAATTCGCAGTGTACGTGGATAACAAG
TTCATGTCCATGCTGACCCCATCAGACATATTCATCGGGGAAATGTCGTT
CTTGCTCAACAACCGGCGCTCTGCAACGATTGTATCAGTAGGCGAAGGCA
CACTGGTAAAGATATCAAAGATGAAGTTCATCTCACTGATTGAGGATCAT
CCTCACTATGGGATCTACCTCGCACGCCTGCTTGCAGGTAGACTTGCCCA
TCAATCGCGCGAGAGCGCAAGCTTAAAAACACCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy