Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-5 IGR725 IGR722 IGR723 IGR724 IGR728 IGR729 IGR726 IGR727 TP0989 rlpA, - TP0993 TP0996 rubR, - TP0991 TP0992 TP0994 TP0988 TP0995 TP0990 TP0989 rlpA, - TP0993 TP0996 rubR, - TP0991 TP0992 TP0994 TP0988 TP0995 TP0990 Type: tandem, Name:  - 221 Type: tandem, Name:  - 218 Type: tandem, Name:  - 219 Type: tandem, Name:  - 220 TP0989 rlpA, - TP0993 TP0996 TP0992 TP0994 TP0988 TP0995 TP0990 rubR, - TP0991
* Calculated from Protein Sequence

Gene ID: TP0991

DNA Molecule Name:
1  

Genbank ID:
3323315

Gene Name:
rubR  

Definition:
rubredoxin

Gene Start:
1076689

Gene Stop:
1076844

Gene Length:
156

Molecular Weight*:
5551

pI*:
3.88

Net Charge*:
-5.97

EC:
1.18.1.-  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Giuliani A, Benigni R, Sirabella P, Zbilut JP, Colosimo A.
Nonlinear methods in the analysis of protein sequences: a case study in rubredoxins.
Biophys J. 2000 Jan;78(1):136-49.
PMID: 10620281

Pierik AJ, Wolbert RB, Portier GL, Verhagen MF, Hagen WR.
Nigerythrin and rubrerythrin from Desulfovibrio vulgaris each contain two mononuclear iron centers and two dinuclear iron clusters.
Eur J Biochem. 1993 Feb;212(1):237-45.
PMID: 8383040

Comment:
In Clostridium perfringens, Rubredoxin is a small nonheme, iron
protein lacking acid-labile sulfide. Its sigles Fe, chelated to 4Cys,
functions as an electron acceptor and may also stabilize the conformation
of the molecule.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to rubredoxin. For
example residues 1-49 are 55% similar to RUBR_CLOPE, rubredoxin of
Clostridium perfringens.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1773
COG name: Rubredoxin
Functional Class:? C
The phylogenetic pattern of COG1773 is AMT---vce-R------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-37 and 11-44 represent significant hits to block BL00202,
Rubredoxin proteins.

ProDom Summary:  Protein Domain Search
Residues 6-44 are 58% similar to rubredoxin of RUBR_CLOPE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 49 (E-value = 1.6e-27) place TP0991 in the Rubredoxin family which is described as Rubredoxin (PF00301)

PDB Hit:
gi|230285|pdb|1RDG| Rubredoxin

Gene Protein Sequence:
MGTYMCDLCGWGYNPEVGDADGGIPAGTAFENLPDHWECPLCGVDKTSFV
KV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAACGTACATGTGTGATTTGTGTGGCTGGGGATACAATCCAGAGGT
AGGGGATGCAGACGGGGGCATTCCCGCGGGTACTGCGTTTGAGAACCTAC
CGGACCACTGGGAGTGTCCACTCTGTGGGGTGGACAAGACAAGTTTTGTG
AAAGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy