Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR716 IGR717 IGR722 IGR723 IGR720 IGR719 IGR721 IGR718 TP0987 TP0989 htpG, - TP0984 TP0983 TP0988 TP0986 TP0981 aspS, - TP0985 TP0990 TP0987 TP0989 htpG, - TP0984 TP0983 TP0988 TP0986 TP0981 aspS, - TP0985 TP0990 Type: tandem, Name:  - 217 Type: tandem, Name:  - 218 Type: tandem, Name:  - 219 TP0987 TP0989 htpG, - TP0984 TP0983 TP0988 TP0986 TP0981 aspS, - TP0985 TP0990 TP0982 TP0982
* Calculated from Protein Sequence

Gene ID: TP0985

DNA Molecule Name:
1  

Genbank ID:
3323310

Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase

Gene Start:
1068702

Gene Stop:
1070507

Gene Length:
1806

Molecular Weight*:
68618

pI*:
6.72

Net Charge*:
-2.93

EC:
6.1.1.12  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Martin F, Sharples GJ, Lloyd RG, Eiler S, Moras D, Gangloff J, Eriani G.
Characterization of a thermosensitive Escherichia coli aspartyl-tRNA synthetase mutant.
J Bacteriol. 1997 Jun;179(11):3691-6.
PMID: 9171418

Sharples GJ, Lloyd RG.
Location of a mutation in the aspartyl-tRNA synthetase gene of Escherichia coli K12.
Mutat Res. 1991 Nov;264(3):93-6.
PMID: 1944398

Eriani G, Dirheimer G, Gangloff J.
Aspartyl-tRNA synthetase from Escherichia coli: cloning and characterisation of the gene, homologies of its translated amino acid sequence with asparaginyl- and lysyl-tRNA synthetases.
Nucleic Acids Res. 1990 Dec;18(23):7109-18.
PMID: 2129559

Comment:
Reaction:
ATP + L-ASPARTATE + TRNA(ASP) = AMP + PYROPHOSPHATE + L-ASPARTYL-TRNA(ASP).

This protein may have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to aspartyl-tRNA
synthetase. For example residues 18-600 are 50% similar to
SYD_THETH, aspartyl-tRNA synthetase of Thermus thermophilus,(X70943).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0173
COG name: Aspartyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0173 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 172-496 are 49% similar to aspartyl-tRNA synthetase of
SYD_THETH. Residues 32-93, 35-64, 79-120, 136-171, and 497-571
also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0609, asparaginyl-tRNA
synthetase and TP1040, lysyl-tRNA synthetase. Residues 37-280
are 24% similar and residues 492-578 are 31% similar to TP0609.
Residues 156-275 are 23% similar to TP1040.

Pfam Summary:  Pfam Search
Residues 35 to 120 (E-value = 1.4e-22) place TP0985 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 137 to 576 (E-value = 8.7e-13) place TP0985 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)
Residues 328 to 422 (E-value = 1.2e-38) place TP0985 in the GAD family which is described as GAD domain (PF02938)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
335  
444

PDB Hit:
gi|1064982|pdb|1ASY|A Saccharomyces cerevisiae

Gene Protein Sequence:
MYSAHTPWYDGQVMDYPRRTIACGELRRCHVGTVVVLNGWVHRKRSHGTV
SFFNMRDRSGIVQVIVSQEENASLWSTVNRIRLECCLAVEGVVRERPPSM
INRALHTGEVEVHARTLYVLSENAVLPFRVDDVVHAHEDIRLKYRYLDLR
SQRMQERIALRSRVALAIRQFLSMKGFIEIETPTFICSTPEGARDFVVPS
RVCPGRFYALPQSPQLYKQLLMVAGFDRYFQLARCYRDEDARGDRQPEFT
QIDLEMSFVSRDDVMRVNEDMLRYVFRTSIGVELPTFFPRLTYAQALDQY
GTDKPDMRFKPVLQNADFMGMLGTFTPFEEVVAQGGSIRALVLPGKARCY
SRRQIEALESIARAHEAHHLFWLKATGGGLEGGIARFFAGVESEVRRRLS
AQDEDLLLFVADCRHRVCCVALGAVRSALIRDESFPEKELFSFVWIVDFP
LFEWNPAENKWDPAHHMFSAPQEQYLETLEQDPGSVKGDLYDLVLNGYEL
ASGSIRIHDTQLQKRIFKIVGLDPEEAGEKFGFLTEAFKYGAPPHGGIAH
GLDRLVMLMTGSESIRDVIAFPKNTLAASPLDNCPSVLDKRQLDELHLTV
HV

Gene Nucleotide Sequence:  Sequence Viewer
TTGTATAGCGCTCACACCCCATGGTATGATGGGCAGGTCATGGATTATCC
GAGAAGGACTATAGCTTGTGGCGAGCTGCGCAGGTGCCACGTCGGAACGG
TAGTTGTGCTCAATGGATGGGTCCACCGAAAGCGGTCGCACGGAACCGTT
AGTTTCTTTAACATGCGCGATAGGTCCGGAATAGTGCAGGTTATAGTGAG
CCAGGAGGAAAACGCTAGCCTGTGGTCCACGGTAAACCGCATACGGTTGG
AATGCTGTCTTGCAGTCGAAGGCGTGGTGCGAGAGCGACCTCCTTCAATG
ATAAATCGCGCCCTGCATACCGGGGAGGTGGAGGTGCACGCTCGCACGCT
GTACGTTCTCTCGGAGAATGCTGTGCTTCCGTTCCGCGTTGATGATGTTG
TGCATGCGCACGAAGATATACGCTTAAAATATCGCTACCTCGACCTGCGC
TCTCAGCGCATGCAGGAGCGCATTGCACTGCGCTCACGCGTTGCCCTGGC
CATACGGCAGTTTTTAAGTATGAAAGGTTTCATCGAGATCGAAACTCCCA
CCTTCATCTGCTCTACCCCCGAGGGGGCACGTGACTTTGTTGTCCCTTCC
CGAGTGTGCCCCGGGCGTTTCTATGCCCTGCCACAGTCCCCCCAGCTGTA
CAAGCAGCTTCTGATGGTGGCAGGGTTTGACCGCTATTTCCAACTTGCCC
GTTGCTACCGAGACGAGGATGCACGAGGCGATCGTCAGCCAGAATTTACC
CAGATAGACCTTGAGATGAGCTTCGTTTCTCGAGACGATGTTATGCGGGT
GAACGAGGATATGCTTCGGTACGTGTTTAGAACCAGCATCGGTGTCGAAC
TGCCTACCTTTTTTCCTCGGCTTACCTACGCGCAGGCGCTAGACCAATAT
GGAACAGATAAGCCAGACATGCGCTTCAAACCGGTCCTGCAGAATGCAGA
CTTTATGGGAATGCTTGGCACGTTCACCCCGTTTGAAGAAGTCGTCGCAC
AGGGTGGCAGCATCAGAGCACTCGTTCTTCCGGGCAAGGCACGTTGCTAC
AGCCGTAGGCAAATCGAAGCGTTGGAGTCTATCGCTCGAGCACATGAGGC
GCACCACCTTTTTTGGCTTAAGGCAACCGGTGGAGGCCTCGAGGGGGGTA
TCGCAAGGTTTTTTGCAGGGGTAGAGTCCGAAGTACGCCGGCGACTTTCT
GCTCAGGATGAAGACTTGTTGCTCTTTGTCGCCGATTGCCGGCACCGCGT
GTGCTGCGTCGCACTCGGCGCAGTGCGCAGCGCTCTTATCAGGGACGAGT
CGTTCCCAGAGAAGGAGTTGTTTTCTTTCGTGTGGATCGTTGATTTTCCC
CTCTTTGAATGGAACCCAGCGGAAAACAAGTGGGACCCTGCTCATCACAT
GTTCTCTGCTCCTCAGGAACAGTATCTTGAGACGCTCGAGCAAGATCCCG
GTTCGGTAAAAGGTGACCTCTATGATTTGGTGCTCAACGGGTATGAGCTG
GCTTCAGGCTCAATTCGTATCCACGACACACAGCTGCAAAAACGCATCTT
TAAGATAGTGGGATTAGATCCTGAAGAAGCGGGGGAAAAGTTCGGGTTTC
TCACAGAAGCGTTTAAATACGGCGCGCCGCCGCACGGCGGCATCGCACAC
GGGTTGGACCGCCTCGTGATGCTCATGACAGGAAGCGAGTCAATTAGAGA
CGTCATTGCTTTTCCTAAAAATACACTCGCCGCCAGCCCCCTGGACAATT
GTCCTAGCGTGCTCGATAAGCGTCAGCTTGACGAGTTACACCTCACTGTA
CACGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy