Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR714 IGR716 IGR717 IGR712 IGR711 IGR710 IGR715 IGR713 TP0974 TP0975 htpG, - TP0984 lsp, - TP0978 TP0983 TP0979 TP0980 TP0981 TP0976 pheS, - TP0973 TP0974 TP0975 htpG, - TP0984 lsp, - TP0978 TP0983 TP0979 TP0980 TP0981 TP0976 pheS, - TP0973 TP0974 TP0975 htpG, - TP0984 lsp, - TP0978 TP0983 TP0979 TP0980 TP0981 TP0976 pheS, - TP0973 TP0982 TP0977 TP0982 TP0977
* Calculated from Protein Sequence

Gene ID: TP0978

DNA Molecule Name:
1  

Genbank ID:
3323300

Gene Name:
lsp  

Definition:
signal peptidase II (lipoprotein signal peptidase)

Gene Start:
1061478

Gene Stop:
1062068

Gene Length:
591

Molecular Weight*:
21907

pI*:
10.23

Net Charge*:
7.28

EC:
3.4.23.46  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Membrane transport; Sec-dependant

Comment:
This protein specifically catalyzes the removal of signal peptides
from prolipoproteins.

Reaction:
CLEAVAGE OF N-TERMINAL LEADER SEQUENCES FROM MEMBRANE PROLIPOPROTEINS.
HYDROLYSES XAA-XBB-XBB-|-CYS, IN WHICH XAA IS HYDROPHOBIC (PREFERABLY
LEU), XBB IS OFTEN SER OR ALA, XCC IS OFTEN GLY OR ALA, AND THE CYS
IS ALKYLATED ON SULFUR WITH A DIACYLGLYCERYL GROUP.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to signal peptidase II.
For example residues 25-177 are 28% similar to LSPA_STAAU, prolipoprotein
signal peptidase of Staphylococcus aureus,(M83994).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0597
COG name: Lipoprotein signal peptidase
Functional Class:  N
The phylogenetic pattern of COG0597 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 60-83, 114-139, 154-173, and 109-128 represent significant
(99%) hits to blocks BL00855A,B,C, Signal peptidases II proteins.

ProDom Summary:  Protein Domain Search
Residues 119-165 are 40% similar to signal peptidase II of LSPA_MYCTU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 22 to 183 (E-value = 1e-10) place TP0978 in the Peptidase_A8 family which is described as Signal peptidase (SPase) II (PF01252)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
79  
105
transmembrane  
145  
176

PDB Hit:
none

Gene Protein Sequence:
MIRSRPLRVDTMKLTRIQKEKWIPLFAAGLVVVLDQCAKLLVGAYVPTNT
SGVRVLGDFVRIVHVYNVGAAFSIGHQLNQVLRTLVLGIVPLIIMFLIVF
SYFRTDAFCPVQRWAVSGIIGGGIGNLIDRFLRPNGVLDFIDVKFFGIFG
FERWPAFNIADAVIMTCGLLLIISFIKQEKEISSQPSCNETGGVFRT

Gene Nucleotide Sequence:  Sequence Viewer
GTGATACGCTCGCGCCCGTTAAGGGTGGATACAATGAAACTCACACGGAT
ACAGAAAGAAAAGTGGATCCCGCTTTTTGCCGCTGGATTAGTTGTTGTTC
TGGATCAGTGCGCTAAATTGTTGGTGGGTGCTTATGTGCCTACAAACACC
TCGGGCGTTCGCGTGCTCGGTGATTTCGTGAGAATTGTTCACGTGTACAA
TGTTGGCGCCGCTTTCAGCATTGGCCATCAGCTAAATCAGGTTCTGCGTA
CGCTCGTGCTCGGTATCGTGCCGCTAATCATTATGTTCCTTATTGTTTTC
TCCTATTTTCGCACTGACGCCTTCTGTCCTGTTCAGCGCTGGGCCGTGTC
AGGGATTATCGGGGGAGGGATAGGGAACTTAATCGATCGCTTCCTGAGGC
CAAACGGGGTGCTCGACTTTATCGACGTAAAGTTCTTTGGCATCTTTGGC
TTTGAGCGCTGGCCCGCTTTTAACATTGCAGATGCGGTCATCATGACCTG
TGGTTTGCTCTTGATCATTTCGTTCATAAAACAAGAAAAAGAGATCAGCT
CCCAACCCTCCTGCAATGAGACGGGGGGCGTTTTTCGCACG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy