Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR707 IGR712 IGR711 IGR710 IGR709 IGR708 IGR713 TP0970 TP0974 tpd, - TP0971 TP0975 TP0972 TP0969 TP0968 lsp, - TP0978 TP0976 pheS, - TP0973 TP0970 TP0974 tpd, - TP0971 TP0975 TP0972 TP0969 TP0968 lsp, - TP0978 TP0976 pheS, - TP0973 Type: tandem, Name:  - 216 TP0974 tpd, - TP0971 TP0975 TP0972 TP0969 TP0968 TP0970 lsp, - TP0978 TP0976 pheS, - TP0973 TP0977 TP0977
* Calculated from Protein Sequence

Gene ID: TP0973

DNA Molecule Name:
1  

Genbank ID:
3323297

Gene Name:
pheS  

Definition:
phenylalanyl-tRNA synthetase alpha subunit

Gene Start:
1056337

Gene Stop:
1057995

Gene Length:
1659

Molecular Weight*:
61224

pI*:
7.07

Net Charge*:
0.78

EC:
6.1.1.20  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-PHENYLALANINE + TRNA(PHE) =
AMP + PYROPHOSPHATE + L-PHENYLALANYL-TRNA(PHE).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phenylalanyl-tRNA
synthetase, alpha subunit. For example residues 8-552 are 46% similar
to SYFA_BORBU, phenylalanyl-tRNA synthetase, alpha subunit of Borrelia
burgdorferi,(AE001153).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0016
COG name: Phenylalanyl-tRNA synthetase alpha subunit
Functional Class:  J
The phylogenetic pattern of COG0016 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 322-443 are 59% similar to phenylalanyl-tRNA synthetase alpha
subunit of SYFA_BORBU. Residues 513-547 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 297 to 539 (E-value = 4.6e-124) place TP0973 in the tRNA-synt_2d family which is described as tRNA synthetases class II core domain (F) (PF01409)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
469  
553

PDB Hit:
gi|2781285|pdb|1PYS|A Chain A, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Phenylalanyl-Trna Synthetase, Class Ii Aminoacyl-Trna Synthetase, Thermus Thermophilus, Rbd Domain, Sh3 Domain, Helix-Turn-Helix Motif Mol_id: 1; Molecule: Phenylalan...

Gene Protein Sequence:
MMPRMTGKADLNTLVHKLHPLEIKVLKNCAMDEILSTSLLISRLGFKEGH
ANQAFSWLRAKRIIEEHQREQMRSFELTPCGYAAASDGTAEERMLTFLSS
PPSLTAIADAAEHLHPRPPLCNGLSLPELAHALTLAPKDVGSAFGILAQE
GILRMDGEKRIHIVSPHVSDRMSLTRTLLQRAAARVASPSEASDTPPGTL
FESELSDDERRVMERIAKKRGASDSLFKVSVRERVTFTFTPTARAVQEAL
HTAGLTGNEIGALTVECLKSGAWKTQHLRRYNVHIPPARIIPGRSNAYAD
FLEHIKDRLVALGFQEFDGPLVETDFWNADALFMPQFHPARDIHDVYYLK
HPTHAPTIPEPFLSRVAATHERGADSGSLGWRYSFDRDFTRRLLLRSQGT
ALSARHLPTAHIPGKYFGIARCFRHDQVDATHLADFYQTEGIVLGTDVNV
CTLLGMLKILATEIAGAQEVRYVGGYFPFTEPSIELHALHPALGWFELGG
AGLLRPEVTDPLGVHVPVMAWGLGVDRMALLALGISDVRELFSPDIESVR
LRV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGCCGCGCATGACAGGTAAAGCCGATCTGAACACGCTTGTGCACAA
GCTGCATCCCCTTGAGATCAAAGTCCTCAAGAACTGCGCAATGGATGAGA
TCCTTTCGACTTCGTTGCTCATCTCCCGGCTAGGCTTTAAGGAAGGACAC
GCAAACCAAGCGTTTTCCTGGCTTCGGGCAAAGCGAATCATCGAAGAGCA
CCAGCGGGAACAGATGCGGTCCTTTGAACTCACCCCCTGCGGCTATGCTG
CCGCTAGCGACGGTACTGCAGAGGAGCGTATGCTCACCTTCTTGTCTTCC
CCCCCTTCCCTTACCGCTATTGCAGATGCAGCCGAGCACCTACACCCTCG
CCCCCCACTTTGCAACGGGCTCAGTCTCCCTGAGCTTGCCCATGCGCTCA
CGCTCGCACCAAAGGATGTAGGTTCAGCGTTCGGTATCCTAGCGCAGGAG
GGTATCCTCCGTATGGACGGTGAAAAACGCATACACATCGTTTCACCGCA
CGTAAGTGATCGCATGTCCCTCACGCGCACCTTGCTTCAGCGCGCCGCTG
CACGCGTCGCTTCCCCGTCAGAGGCCTCGGACACTCCTCCAGGCACCCTC
TTTGAATCTGAGCTCTCTGATGATGAGCGACGTGTAATGGAACGCATAGC
AAAAAAGCGGGGCGCAAGCGACAGCCTCTTCAAAGTCAGTGTACGCGAGA
GGGTAACGTTCACCTTTACCCCCACCGCCCGTGCCGTGCAGGAGGCGCTG
CATACCGCAGGGCTTACCGGAAACGAGATAGGTGCACTCACCGTCGAGTG
CCTAAAAAGTGGCGCGTGGAAGACACAACATCTACGCCGCTACAACGTTC
ACATTCCCCCTGCCCGCATCATCCCCGGCCGATCTAATGCCTACGCAGAT
TTCCTCGAACACATCAAAGATCGTCTGGTGGCACTTGGCTTTCAGGAATT
TGACGGGCCACTGGTGGAAACAGACTTCTGGAACGCGGACGCGCTGTTCA
TGCCACAGTTCCATCCTGCACGGGACATTCATGATGTGTATTACCTCAAA
CACCCAACGCACGCACCTACAATCCCAGAGCCGTTCCTCTCCCGCGTTGC
GGCGACGCATGAACGCGGAGCAGATAGCGGGAGCCTCGGCTGGCGCTACT
CGTTCGATCGGGATTTTACCCGCCGACTGCTATTACGCAGCCAAGGAACA
GCACTTTCAGCGCGCCACCTGCCAACCGCCCACATACCGGGTAAGTATTT
TGGGATCGCACGCTGCTTCCGTCACGACCAAGTGGATGCGACGCACCTTG
CAGATTTCTACCAAACAGAAGGAATCGTACTGGGTACGGATGTGAACGTC
TGTACCCTTCTAGGCATGCTCAAAATCCTCGCAACAGAAATCGCCGGTGC
ACAGGAGGTACGCTACGTGGGCGGGTACTTTCCGTTCACGGAGCCCTCTA
TCGAGCTACACGCACTCCACCCCGCACTCGGCTGGTTCGAACTGGGAGGA
GCAGGTCTCCTGCGCCCAGAAGTGACCGACCCGCTCGGCGTGCACGTCCC
CGTCATGGCCTGGGGACTAGGAGTAGACCGCATGGCGCTCCTGGCGCTCG
GTATCTCAGACGTGCGAGAACTGTTCAGCCCAGACATCGAGAGCGTCCGC
CTGAGGGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy