Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR691 IGR689 IGR688 IGR695 IGR693 IGR694 IGR697 IGR696 IGR692 IGR690 rpmH, - TP0951 TP0955 TP0950 TP0947 jag, - TP0948 TP0952 traB, - TP0953 TP0954 TP0949 gidB, - TP0946 TP0956 Tp33, - TP0957 rpmH, - TP0951 TP0955 TP0950 TP0947 jag, - TP0948 TP0952 traB, - TP0953 TP0954 TP0949 gidB, - TP0946 TP0956 Tp33, - TP0957 Type: tandem, Name:  - 306 Type: tandem, Name:  - 212 Type: tandem, Name:  - 213 Type: tandem, Name:  - 277 TP0955 TP0950 TP0947 jag, - TP0948 TP0952 traB, - TP0953 TP0954 TP0949 rpmH, - TP0951 gidB, - TP0946 TP0956 Tp33, - TP0957
* Calculated from Protein Sequence

Gene ID: TP0952

DNA Molecule Name:
1  

Genbank ID:
3323272

Gene Name:


Definition:
possible lipase precursor

Gene Start:
1033777

Gene Stop:
1032743

Gene Length:
1035

Molecular Weight*:
39669

pI*:
8.77

Net Charge*:
8.08

EC:
3.1.1.3  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Miscellaneous Enzymes

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle of the protein had significant hits
to two lipase precursors. Residues 78-264 are 26% similar to lipase
precursor of Streptomyces albus,(U03114).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0596
COG name: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)
Functional Class:  R
The phylogenetic pattern of COG0596 is A---Yq-CEBR-ujgp----X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 165-178, 179-192, and 223-237 represent significant (99%)
hits to blocks PR00111B,C,D, ALPHA/BETA HYDROLASE FOLD SIGNATURE.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
29

PDB Hit:
none

Gene Protein Sequence:
MLCLFLCGCVMKKWCGLAFSIFFSFFLRAQDLTFQEVFEVAACNDDVSLL
NKMHKRTVRDNQFDEQLTDRVHLRYPASVYYPAHQGTYPLIMLSRGWNST
QDYQRALARFLAAQGFVTVVFTSRAQRRPPDFLSTFDSVYALMQRVNEQE
GSPLYRKVDFTRVGVLGHSMGGTAALHYANRYPERIRTVVALHPFNGGAD
MVNMVGGKNEQLGTDLRSVRAAVLILTGTKDMLAYPERSYEFFQSLPQDV
PACFLSLKGMGHGAGTDKYFEVWGFTYNKTLSVESFALYRRLISAWFRLF
LREEEEYRALFNEHGRPFRNLKPHLSQETGRAHSYPFFCEQNISN

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTATGCTTGTTTCTGTGCGGGTGTGTGATGAAAAAATGGTGTGGGTT
GGCATTTAGTATTTTCTTCTCGTTTTTCTTGCGTGCGCAGGATCTTACTT
TCCAAGAAGTCTTCGAAGTGGCGGCGTGTAACGATGATGTCTCCCTTCTG
AATAAAATGCACAAGCGTACTGTGCGTGATAATCAGTTTGATGAGCAACT
CACTGACCGAGTGCACCTGCGTTATCCTGCCTCGGTGTATTATCCAGCGC
ATCAGGGTACGTATCCGCTTATCATGCTTTCGCGCGGATGGAATAGCACG
CAAGATTATCAGCGTGCGTTAGCGCGCTTTCTGGCTGCACAGGGATTTGT
CACGGTGGTGTTTACGTCGCGAGCTCAGCGGCGGCCACCCGATTTTTTGA
GTACGTTTGATAGTGTCTATGCACTTATGCAGCGCGTAAATGAGCAGGAG
GGCTCTCCTCTGTATCGAAAGGTTGATTTTACGCGTGTAGGGGTGTTGGG
ACACTCGATGGGTGGTACAGCTGCCCTGCACTATGCAAATCGGTACCCTG
AGCGTATTCGAACGGTAGTTGCGTTGCATCCCTTTAACGGGGGCGCTGAT
ATGGTGAACATGGTTGGGGGAAAAAACGAGCAACTGGGAACTGATTTGCG
CTCGGTACGTGCTGCGGTGCTGATTCTGACGGGAACAAAGGATATGTTGG
CATATCCTGAACGGTCGTATGAGTTCTTTCAGAGTTTACCACAGGATGTG
CCTGCGTGCTTTTTGTCGCTAAAAGGTATGGGACATGGGGCGGGGACGGA
TAAATATTTTGAAGTGTGGGGATTTACGTACAACAAAACGCTGAGTGTGG
AATCGTTCGCGTTGTACCGTCGCCTGATATCAGCCTGGTTTCGCCTTTTT
TTGCGGGAAGAAGAGGAATATCGCGCCTTATTTAATGAACATGGGAGACC
GTTCCGGAATTTAAAGCCTCACTTATCGCAAGAAACAGGGCGCGCACACT
CCTATCCCTTTTTCTGTGAGCAAAACATTTCGAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy