Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR691 IGR684 IGR681 IGR689 IGR682 IGR688 IGR685 IGR683 IGR693 IGR692 IGR687 IGR690 IGR686 TP0940 rpmH, - TP0951 TP0950 flaJ,fliS, - TP0943 TP0942 TP0941 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0952 TP0944 traB, - TP0953 TP0949 nifJ, - TP0939 gidB, - TP0946 TP0940 rpmH, - TP0951 TP0950 flaJ,fliS, - TP0943 TP0942 TP0941 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0952 TP0944 traB, - TP0953 TP0949 nifJ, - TP0939 gidB, - TP0946 Type: tandem, Name:  - 306 Type: tandem, Name:  - 211 Type: tandem, Name:  - 212 Type: tandem, Name:  - 213 TP0950 TP0942 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0944 traB, - TP0953 TP0949 nifJ, - TP0939 rpmH, - TP0951 flaJ,fliS, - TP0943 TP0941 TP0952 TP0940 gidB, - TP0946
* Calculated from Protein Sequence

Gene ID: TP0947

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
peptidyl-prolyl cis-trans isomerase (cyclophilin B)

Gene Start:
1029196

Gene Stop:
1028552

Gene Length:
645

Molecular Weight*:
23257

pI*:
8.13

Net Charge*:
3.86

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
PPiases accelerate the folding of proteins.

Reaction:
CIS-TRANS ISOMERIZATION OF PROLINE IMIDIC PEPTIDE BONDS IN OLIGOPEPTIDES.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed this protein is identical to peptidyl-prolyl
cis-trans isomerase of Treponema pallidum,(U97573). In addition there
are several other significant hits to peptidyl-prolyl cis-trans isomerase
and cyclophilin B proteins. For example residues 42-175 are 47%
similar to CYPI_MYCTU, peptidyl-prolyl cis-trans isomerase of
Mycobacterium tuberculosis,(Z80233).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0652
COG name: Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family
Functional Class:  O
The phylogenetic pattern of COG0652 is --t-Y--CEbRhuj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 49-75, 84-123, 89-128, and 131-172 represent significant (100%)
hits to blocks BL00170A,B,C, Cyclophilin-type peptidyl-prolyl cis-trans
isomerase signature.

ProDom Summary:  Protein Domain Search
Residues 53-128 are 54% similar to peptidyl-prolyl cis-trans isomerase
of CYPI_MYCTU. Residues 44-118 and 129-154 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 41 to 192 (E-value = 9.4e-64) place TP0947 in the Pro_isomerase family which is described as Cyclophilin type peptidyl-prolyl cis-trans isomerase (PF00160)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
24

PDB Hit:
gi|1310882|pdb|1CYN|A Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Cyclosporin, Isomerase, Rotamase, Signal Mol_id: 1; Molecule: Cyclophilin B; Chain: A; Engineered: Yes; Mol_id: 2; Molecule: [d-(Cholinyl)ala]8-Cyclosporin; Chain: C...

Gene Protein Sequence:
MNTQVWRVCVGVMLFCFVGRIGCAEEKMVREEGLAVADGIYAVMETNRGT
IVLSLFFEKAPLTVCNFVGLAEGTLAVCKGRPFYQGLTFHRVIKDFMIQG
GDPQGNGTGGPGYQFPDECDPALRHDSPGVLSMANAGPGTNGSQFFITHV
ATPWLDGKHTVFGKVVEGMEVVHAIIAGDTIRSLKIVRRGAAAKRFVCDQ
AQFDQLRKRVSAASK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACGCAGGTGTGGCGCGTCTGTGTGGGGGTGATGTTGTTCTGCTT
CGTTGGCAGGATCGGGTGTGCGGAGGAAAAAATGGTACGCGAGGAAGGGT
TGGCGGTCGCTGACGGTATATATGCGGTAATGGAAACAAATCGGGGAACG
ATTGTTCTCTCGCTTTTTTTTGAAAAGGCGCCGCTTACGGTGTGTAATTT
TGTGGGGTTAGCAGAGGGAACGTTGGCGGTGTGCAAGGGTCGTCCTTTTT
ATCAGGGGTTAACGTTTCACCGTGTTATCAAAGATTTTATGATCCAGGGG
GGAGACCCGCAGGGAAATGGGACGGGAGGTCCTGGCTATCAATTCCCCGA
TGAATGTGATCCTGCGTTGCGACACGACAGCCCAGGAGTGTTGTCAATGG
CGAATGCAGGACCAGGAACGAACGGTTCGCAGTTTTTTATTACCCACGTG
GCTACGCCGTGGTTGGATGGAAAGCATACCGTGTTTGGCAAAGTCGTTGA
GGGTATGGAAGTGGTGCATGCAATTATAGCGGGAGATACGATTCGCTCAC
TCAAAATAGTGCGCCGTGGTGCGGCAGCGAAGCGTTTTGTCTGCGATCAG
GCGCAGTTCGACCAGCTGCGAAAACGGGTATCCGCAGCGTCCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy