Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR684 IGR681 IGR689 IGR682 IGR688 IGR685 IGR683 IGR687 IGR690 IGR686 TP0940 TP0950 flaJ,fliS, - TP0943 TP0942 TP0941 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0944 TP0949 nifJ, - TP0939 gidB, - TP0946 TP0940 TP0950 flaJ,fliS, - TP0943 TP0942 TP0941 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0944 TP0949 nifJ, - TP0939 gidB, - TP0946 Type: tandem, Name:  - 306 Type: tandem, Name:  - 211 Type: tandem, Name:  - 212 Type: tandem, Name:  - 213 TP0950 flaJ,fliS, - TP0943 TP0941 TP0947 cfxE,rpeC, - TP0945 jag, - TP0948 TP0944 TP0949 nifJ, - TP0939 TP0940 TP0942 gidB, - TP0946
* Calculated from Protein Sequence

Gene ID: TP0945

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cfxE  rpeC  

Definition:
ribulose-phosphate 3-epimerase (pentose-5-phosphate 3-epimerase)

Gene Start:
1027684

Gene Stop:
1027031

Gene Length:
654

Molecular Weight*:
23499

pI*:
6.50

Net Charge*:
-2.79

EC:
5.1.3.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Carbohydrate metabolism; Pentose phosphate cycle
Energy metabolism; Carbon fixation

Secondary Evidence:
Kusian,B., Yoo,J.G., Bednarski,R. and Bowien,B.
The Calvin cycle enzyme pentose-5-phosphate 3-epimerase is encoded within the cfx operons of the chemoautotroph Alcaligenes eutrophus.
J. Bacteriol. 174 (22): 7337-7344 (1992)
Medline: 93054349.

Comment:
Reaction:
D-RIBULOSE 5-PHOSPHATE = D-XYLULOSE 5-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed this protein is identical to previously published pentose-5-phosphate 3-epimerase homolog of Treponema pallidum,(U97573). In addition there were several other significant hits to ribulose-5-phosphate 3-epimerases.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0036
COG name: Pentose-5-phosphate-3-epimerase
Functional Class:  G
The phylogenetic pattern of COG0036 is -m--yqvcEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 7-21, 30-51, 64-94, 106-158, and 174-203 represent significant
(100%) hits to blocks BL01085A,B,C,D,E, Ribulose-phosphate 3-epimerase
family proteins.

ProDom Summary:  Protein Domain Search
Residues 35-92 are 61% similar to ribulose-phosphate 3-epimerase of
RPE_RHORU. Residues 94-158 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 6 to 206 (E-value = 6.5e-89) place TP0945 in the Ribul_P_3_epim family which is described as Ribulose-phosphate 3 epimerase family (PF00834)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
116  
141

PDB Hit:
none

Gene Protein Sequence:
MERSFTLAPSLLSADFSALDRALVYLEAHGAQWVHLDVMDGHFVPNLTFG
APVLRCLRSKTHLPFDVHLMVSRPADLIEDFVQAGADFLTFHIEAEVHAH
RLIHAIRGRGVKVGISLVPSTPVAALSEVLPFVDLVLVMTVNPGFSGQQM
IAHCLSKVSALVQMRTERGYSYMISVDGGIDCRTLPQALDAGADVIVSGS
AFFSGTLRSLLCKDSSGA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGCGGTCTTTTACATTGGCACCTTCACTATTAAGTGCAGATTTCTC
TGCGCTCGATAGGGCGCTGGTGTATTTGGAAGCGCACGGCGCACAGTGGG
TGCACCTGGATGTTATGGATGGGCACTTTGTGCCAAACCTGACGTTTGGT
GCTCCGGTGCTGCGTTGTTTGCGTAGCAAAACGCACCTGCCGTTTGATGT
TCACCTGATGGTCAGTAGGCCTGCCGACCTCATTGAGGATTTTGTGCAGG
CGGGCGCGGACTTCTTAACTTTTCACATAGAGGCGGAGGTGCATGCACAC
CGGCTTATCCATGCCATTCGTGGTCGGGGAGTGAAGGTGGGTATTAGCCT
CGTGCCGTCTACTCCTGTTGCTGCGCTCAGTGAAGTGCTGCCCTTCGTGG
ACCTAGTGCTGGTAATGACGGTTAATCCTGGTTTTAGCGGACAGCAGATG
ATTGCCCATTGCCTTTCTAAAGTGTCAGCACTTGTGCAGATGCGCACCGA
ACGGGGGTATTCGTACATGATCTCGGTTGATGGGGGCATCGACTGTCGCA
CGTTGCCGCAGGCGCTTGACGCTGGTGCGGATGTGATAGTGTCAGGCTCT
GCTTTTTTTTCCGGTACCTTGAGGTCTCTTCTCTGCAAGGACAGCTCAGG
GGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy