Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 IGR684 IGR681 IGR682 IGR685 IGR680 IGR683 IGR686 IGR679 IGR678 TP0940 flaJ,fliS, - TP0943 TP0942 TP0941 TP0937 cfxE,rpeC, - TP0945 TP0938 TP0935 hlyC, - TP0936 TP0944 nifJ, - TP0939 TP0940 flaJ,fliS, - TP0943 TP0942 TP0941 TP0937 cfxE,rpeC, - TP0945 TP0938 TP0935 hlyC, - TP0936 TP0944 nifJ, - TP0939 Type: tandem, Name:  - 211 flaJ,fliS, - TP0943 TP0941 TP0937 cfxE,rpeC, - TP0945 TP0938 TP0935 hlyC, - TP0936 TP0944 nifJ, - TP0939 TP0940 TP0942
* Calculated from Protein Sequence

Gene ID: TP0939

DNA Molecule Name:
1  

Genbank ID:
3323259

Gene Name:
nifJ  

Definition:
pyruvate-flavodoxin dehydrogenase (pyruvate-ferredoxin oxidoreductase)

Gene Start:
1023930

Gene Stop:
1020379

Gene Length:
3552

Molecular Weight*:
129818

pI*:
6.90

Net Charge*:
-1.34

EC:
1.-.-.-  

Functional Class:
Energy metabolism; Fermentation  

Pathway: pathway table
Carbohydrate metabolism; Pyruvate metabolism

Secondary Evidence:
Schmitz O, Gurke J, Bothe H.
Molecular evidence for the aerobic expression of nifJ, encoding pyruvate:ferredoxin oxidoreductase, in cyanobacteria.
FEMS Microbiol Lett. 2001 Feb;195(1):97-102.
PMID: 11167002

Lindblad A, Jansson J, Brostedt E, Johansson M, Hellman U, Nordlund S.
Identification and sequence of a nifJ-like gene in Rhodospirillum rubrum: partial characterization of a mutant unaffected in nitrogen fixation.
Mol Microbiol. 1996 May;20(3):559-68.
PMID: 8736535

Bauer CC, Scappino L, Haselkorn R.
Growth of the cyanobacterium Anabaena on molecular nitrogen: NifJ is required when iron is limited.
Proc Natl Acad Sci U S A. 1993 Oct;90(19):8812-6.
PMID: 8415612

Schmitz O, Kentemich T, Zimmer W, Hundeshagen B, Bothe H.
Identification of the nifJ gene coding for pyruvate: ferredoxin oxidoreductase in dinitrogen-fixing cyanobacteria.
Arch Microbiol. 1993;160(1):62-7.
PMID: 8352652

Comment:
This protein is an oxidoreductase required for the transfer of
electrons from pyruvate to flavodoxin.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to pyruvate-flavodoxin
dehydrogenase. For example residues 1-1182 are 58% similar to
NIFJ_SYNY3, pyruvate-ferredoxin oxidoreductase of Synechocystis sp.,
(D64005).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0674
COG name: Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit
Functional Class:? C
The phylogenetic pattern of COG0674 is AMTKYQVce-r-UJ---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 696-707 and 752-763 represent significant (99%) hits to
block BL00198, 4Fe-4S ferredoxins, iron-sulfur binding region
proteins. Residues 747-758 and 691-702 represent significant (98%)
hits to block PR00352A, 3FE-4S FERREDOXIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 332-907 are 55% similar to pyruvate-ferredoxin oxidoreductase
of NIFJ_ANASP. Residues 9-244, 248-297, 299-330, 692-763, and 965-1166
also support this match. Residues 685-763 are 31% similar to photosystem
I iron-sulphur center PSAC_CYAPA.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 17 to 249 (E-value = 4e-124) place TP0939 in the POR_N family which is described as Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain (PF01855)
Residues 433 to 617 (E-value = 1.6e-72) place TP0939 in the POR family which is described as Pyruvate ferredoxin/flavodoxin oxidoreductase (PF01558)
Residues 689 to 712 (E-value = 6.7e-08) place TP0939 in the Fer4 family which is described as 4Fe-4S binding domain (PF00037)
Residues 745 to 768 (E-value = 2.1e-05) place TP0939 in the Fer4 family which is described as 4Fe-4S binding domain (PF00037)
Residues 824 to 1089 (E-value = 1.7e-101) place TP0939 in the TPP_enzyme_C family which is described as Thiamine pyrophosphate enzyme, C-terminal TPP binding domain (PF02775)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
935  
970
coil-coil  
1157  
1184

PDB Hit:
none

Gene Protein Sequence:
MSEKNLVMMDGNTAVGHVAHALSEVIAIFPITPSSPMGEIADEYSARGRT
NIWGTVPTVVELQSEAGASGAVHGALTTGALSSTFTASQGLLLMIPNMYK
IAGELTSAVFHVAARAVATSSLSIFGDHQDVMACRQTGWALLASNSVQEA
MDTAVIAHAATLEARVPFVHFFDGFRTSHEIQKIEEVSYDVMRAMIDDEL
VHAHRMRGLTPEKPVVRGTAQNPDVYFQVRESVNRYYAVAPSIVQKAMDR
YAALTGRQYRLFDYYGAPDAEKVIVMIGSGSEAVEETVDVLNAQGGKCGL
VKVRLYRPFSAECFVNALPKTVQAIAVLDRTKEPGSLGEPLYEDVRTAIG
QMQSQKKCPFTHYPLVLGGRYGLGSKEFTPAMAKGVFDNLSGKKIPNFSV
GIEDDVTFSSVDFDPNFQLDDQDVCQAVFYGLGSDGTVGANKNSIKIIGE
ATDNNAQAYFAYDSKKSGGFTISHLRFGKQKIRKPYLITQADFVACHKFT
YLETFDMLKTLKRGGTFLLNAPYSEHEVWHHIPIEVQRQIIEKEVKFYVI
DAISIAQKAGMGTRINVVMQTAFFKIFGILPEAEAIDLIKKFIQKAYGKK
GGEVVQRNITTIDMALAGVGLVEYPGVAGSLVTRRPAMSSDAPEFVQSVL
GTIALNQGDSLGVSALPEDGTYPTGTTQYEKRCIAETIPIWDPSVCIQCG
QCAMVCPHAVIRMKAYDGKELEHAPSKFASCDYKGKEFGEAKFTIQVSPE
DCTGCGLCVQQCPAKNKADPTRKAINMESFSKHRAVESENWAFFVKLPDP
EAKKLNLSLPKGASMKRPLFEFSGACPGCGETPYIRLMTQIVGDRAIIAN
ATGCSSIYGGNLPTTPYTTRPDGRGPAWSNSLFEDAAEFGFGMRVTSDKL
AEYAREVGRKLQEKGVAADLFASIFSNQQADDVAVEEQRAYVNQLKKVLS
ESTEPLAKEMLSLVDHLIKRSVWIFGGDGWAYDIGYGGLDHVLASGRNIT
VLVMDTEVYSNTGGQMSKATPIGAVAKFAAAGKEISKKDIGLMAMSYGYV
YVARVAMGANMSQVVKAFREAESYDGPSLIVAYSHCISHGIDMSKGMINQ
KEAVACGLWPLYRYDPRRIAEGKNPFQLDSKEPDFKLADFMYKEVRFKTL
KNANPERAEMLLKRAEEKARRQWQEYKYLADRPF

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGAGAAGAACCTCGTCATGATGGATGGTAACACCGCAGTGGGGCA
CGTTGCTCACGCGCTTAGTGAGGTCATTGCTATCTTCCCTATCACTCCCT
CCAGTCCTATGGGAGAAATCGCAGACGAATATTCCGCACGGGGGCGCACA
AATATCTGGGGTACCGTTCCCACCGTTGTAGAACTTCAGTCTGAGGCAGG
CGCTTCGGGAGCTGTTCATGGCGCACTGACGACGGGGGCGCTCTCTTCTA
CTTTTACTGCTTCTCAGGGATTGCTGCTTATGATCCCGAATATGTATAAG
ATCGCAGGGGAGCTTACGAGCGCTGTTTTTCACGTTGCTGCACGCGCTGT
CGCCACAAGTTCTCTTTCTATCTTTGGTGATCATCAAGACGTGATGGCGT
GCCGCCAGACAGGTTGGGCGCTCCTTGCTTCCAACAGTGTTCAGGAGGCC
ATGGACACCGCAGTTATTGCTCATGCTGCGACGCTCGAGGCGCGCGTGCC
TTTTGTTCATTTTTTTGACGGTTTTAGGACTTCTCATGAGATTCAGAAAA
TTGAAGAAGTCTCTTATGACGTCATGCGTGCTATGATCGACGACGAACTT
GTCCATGCGCACCGCATGCGTGGACTGACTCCCGAAAAGCCAGTGGTCCG
CGGCACAGCACAGAATCCTGATGTGTATTTTCAGGTCCGCGAATCAGTGA
ATAGGTACTATGCGGTTGCGCCCTCCATTGTCCAAAAAGCTATGGACCGC
TACGCGGCGCTTACCGGACGCCAGTACCGTCTTTTCGATTACTACGGTGC
ACCCGATGCAGAGAAGGTGATTGTCATGATTGGCTCCGGCTCTGAGGCCG
TTGAAGAGACAGTTGATGTGCTCAATGCTCAGGGAGGAAAGTGTGGTCTA
GTCAAGGTGCGCTTGTATCGCCCGTTCAGCGCAGAGTGTTTTGTCAATGC
ATTGCCCAAAACGGTGCAGGCGATTGCAGTGCTCGATCGAACGAAAGAGC
CAGGTTCTCTGGGCGAACCTCTCTATGAGGATGTGCGCACCGCTATCGGC
CAGATGCAGAGCCAGAAGAAGTGTCCGTTTACGCATTACCCTCTCGTGCT
CGGTGGTCGCTATGGCCTGGGTTCTAAGGAGTTTACGCCCGCGATGGCCA
AAGGAGTGTTTGATAACCTCAGTGGGAAGAAGATCCCGAACTTCTCGGTC
GGTATAGAGGATGATGTTACGTTCAGCAGCGTAGACTTTGATCCGAACTT
TCAGCTTGATGATCAAGATGTGTGTCAGGCGGTGTTCTATGGTCTGGGCT
CGGACGGTACAGTAGGCGCGAATAAAAATTCAATTAAGATTATTGGTGAG
GCGACGGATAATAACGCGCAGGCTTACTTTGCCTACGATAGCAAGAAGTC
TGGTGGTTTTACTATTTCTCATTTGCGTTTTGGAAAGCAGAAGATCCGTA
AGCCCTACCTCATTACGCAGGCGGATTTTGTAGCGTGTCATAAGTTTACG
TACCTTGAAACCTTTGACATGCTCAAAACGCTCAAGCGTGGAGGGACCTT
TTTGCTGAATGCGCCGTACAGTGAGCATGAGGTGTGGCATCACATACCCA
TAGAAGTCCAGCGTCAGATCATTGAAAAGGAGGTGAAGTTTTACGTCATC
GATGCGATTTCTATCGCTCAGAAGGCGGGGATGGGCACACGTATCAATGT
GGTGATGCAAACGGCTTTTTTCAAAATTTTTGGTATCTTGCCGGAAGCTG
AGGCGATTGACCTGATTAAGAAATTTATACAGAAGGCCTACGGCAAAAAG
GGTGGGGAGGTTGTACAGAGGAACATCACCACTATCGATATGGCGCTCGC
TGGGGTGGGATTGGTGGAGTATCCGGGAGTTGCCGGTAGTTTGGTGACGC
GTCGTCCTGCGATGAGTTCCGATGCTCCGGAGTTTGTGCAAAGCGTGTTA
GGTACTATTGCGCTCAATCAGGGGGATAGTCTTGGGGTGAGCGCACTACC
AGAGGATGGTACCTATCCTACTGGTACCACGCAGTACGAGAAGCGCTGTA
TAGCCGAGACTATACCCATTTGGGATCCGTCTGTTTGTATCCAGTGTGGT
CAGTGCGCTATGGTGTGTCCTCACGCAGTTATCCGCATGAAAGCGTACGA
TGGTAAGGAGCTCGAGCATGCGCCTTCTAAGTTTGCTTCCTGTGACTACA
AAGGCAAGGAATTTGGGGAGGCGAAGTTTACGATTCAGGTTTCCCCAGAG
GACTGCACAGGTTGTGGCCTGTGCGTGCAGCAATGTCCGGCAAAAAATAA
GGCTGATCCTACGCGTAAGGCTATCAACATGGAAAGTTTTTCCAAGCACC
GTGCGGTGGAGTCTGAGAACTGGGCCTTCTTTGTTAAACTGCCCGATCCT
GAGGCGAAGAAGCTCAATTTGAGTCTGCCAAAAGGGGCGTCCATGAAAAG
ACCTCTTTTTGAGTTCTCTGGTGCCTGCCCAGGCTGCGGGGAGACCCCCT
ACATCCGCTTGATGACGCAGATTGTTGGGGATCGCGCCATTATCGCGAAT
GCAACCGGATGTTCTTCGATATATGGGGGAAATTTGCCTACAACCCCCTA
TACGACGCGTCCTGATGGTCGCGGCCCCGCTTGGTCAAATTCTCTTTTCG
AAGACGCAGCAGAGTTTGGCTTCGGAATGCGCGTGACTAGTGACAAACTT
GCAGAGTATGCCCGCGAGGTTGGACGCAAGTTGCAGGAAAAAGGGGTGGC
GGCTGATCTGTTTGCGAGTATTTTTTCTAACCAGCAGGCGGACGATGTTG
CAGTGGAAGAGCAGCGTGCCTACGTTAATCAGCTTAAGAAAGTGCTCAGT
GAGAGTACTGAACCCCTTGCAAAGGAAATGCTTTCTCTCGTTGACCACCT
TATCAAACGCTCGGTGTGGATTTTTGGGGGAGACGGCTGGGCCTATGATA
TTGGCTACGGTGGTCTAGATCACGTGTTGGCCTCTGGGCGCAATATTACC
GTCCTTGTTATGGATACGGAGGTGTATTCCAACACCGGTGGTCAGATGTC
GAAGGCCACGCCTATCGGGGCCGTCGCAAAGTTTGCCGCGGCGGGGAAGG
AGATCAGTAAAAAGGATATTGGTTTGATGGCCATGAGCTATGGGTATGTG
TACGTGGCACGTGTCGCGATGGGAGCGAACATGAGTCAAGTGGTCAAGGC
GTTTAGAGAGGCTGAAAGTTATGATGGTCCATCGCTTATTGTCGCCTACA
GCCACTGTATTAGCCACGGGATTGATATGTCCAAGGGCATGATTAATCAG
AAAGAGGCCGTCGCGTGTGGTTTGTGGCCGTTGTACCGCTACGATCCCCG
TCGCATTGCGGAAGGAAAAAATCCATTTCAGCTTGACAGTAAGGAACCTG
ATTTTAAGCTTGCGGATTTCATGTACAAAGAAGTTCGGTTCAAGACGCTT
AAGAATGCAAATCCCGAGCGAGCTGAAATGCTGCTCAAGCGCGCAGAAGA
GAAGGCGCGGAGACAGTGGCAAGAGTACAAGTACCTTGCGGACCGTCCGT
TC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy