Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 IGR676 IGR675 IGR672 IGR673 IGR674 IGR677 IGR679 IGR678 TP0932 TP0937 TP0935 hlyC, - TP0936 TP0931 murE, - TP0933 TP0928 TP0929 TP0934 TP0930 TP0932 TP0937 TP0935 hlyC, - TP0936 TP0931 murE, - TP0933 TP0928 TP0929 TP0934 TP0930 Type: tandem, Name:  - 208 Type: tandem, Name:  - 209 Type: tandem, Name:  - 210 TP0932 TP0937 TP0935 hlyC, - TP0936 TP0931 murE, - TP0933 TP0929 TP0934 TP0930 TP0928
* Calculated from Protein Sequence

Gene ID: TP0933

DNA Molecule Name:
1  

Genbank ID:
3323248

Gene Name:
murE  

Definition:
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase

Gene Start:
1015120

Gene Stop:
1013501

Gene Length:
1620

Molecular Weight*:
59447

pI*:
7.01

Net Charge*:
0.10

EC:
6.3.2.13  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Amino acid metabolism; Lysine biosynthesis
Metabolism of complex carbohydrates; Peptideglycan biosynthesis

Secondary Evidence:
Dementin S, Bouhss A, Auger G, Parquet C, Mengin-Lecreulx D, Dideberg O, van Heijenoort J, Blanot D.
Evidence of a functional requirement for a carbamoylated lysine residue in MurD, MurE and MurF synthetases as established by chemical rescue experiments.
Eur J Biochem. 2001 Nov;268(22):5800-7.
PMID: 11722566

Wijayarathna CD, Wachi M, Nagai K.
Isolation of ftsI and murE genes involved in peptidoglycan synthesis from Corynebacterium glutamicum.
Appl Microbiol Biotechnol. 2001 May;55(4):466-70.
PMID: 11398928

Jana M, Luong TT, Komatsuzawa H, Shigeta M, Lee CY.
A method for demonstrating gene essentiality in Staphylococcus aureus.
Plasmid. 2000 Jul;44(1):100-4.
PMID: 10873532

Mengin-Lecreulx D, Falla T, Blanot D, van Heijenoort J, Adams DJ, Chopra I.
Expression of the Staphylococcus aureus UDP-N-acetylmuramoyl- L-alanyl-D-glutamate:L-lysine ligase in Escherichia coli and effects on peptidoglycan biosynthesis and cell growth.
J Bacteriol. 1999 Oct;181(19):5909-14.
PMID: 10498701

Comment:
This protein is involved in cell wall formation. It adds diaminopimelic
acid.

Reaction:
ATP + UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE +
MESO-2,6-DIAMINOHEPTANEDIOATE =
ADP + ORTHOPHOSPHATE +
UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMYL-MESO-2,6-DIAMINOHEPTANEDIOATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to UDP-N-acetylmuramoylalanyl-
D-glutamate--2,6-diaminopimelate ligase. For example residues 25-529
are 35% similar to UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
ligase of Borrelia burgdorferi,(AE001130).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0769
COG name: UDP-N-acetylmuramyl tripeptide synthase
Functional Class:? M
The phylogenetic pattern of COG0769 is --T--qvCebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 109-143, 161-196, and 447-480 represent significant (99%)
hits to blocks BL01011A,B,C, Folylpolyglutamate synthase proteins.

ProDom Summary:  Protein Domain Search
Residues 26-266 are 36% similar to UDP-N-acetylmuramoylalanyl-D-glutamate-
-2,6-diaminopimelate ligase of MURE_BACSU. Residues 418-522 also
support this match. Residues 84-231 are 26% similar to UDP-N-
acetylmuramoylalanine--D-glutamate ligase of MURD_HAEIN.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0386 UDP-N-
acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-
alanine ligase. Residues 29-382 are 23% similar to TP0386.

Pfam Summary:  Pfam Search
Residues 38 to 362 (E-value = 1.3e-35) place TP0933 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 371 to 462 (E-value = 5e-18) place TP0933 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
341  
358

PDB Hit:
none

Gene Protein Sequence:
MLYRKPITVCLASCSVQETHGSACDVSSIAYDSRAVREGSVFFALRGTHA
HGAQYIHAAIDAGACAIVHDCPLDTYVVGVYYARVPDARCALSSAAAAFY
DFPTRALTVIGVTGTEGKSSTVSFIAQLLRLCGKRVGFISTVEYSLGDDI
LPNAEHQTTPESLTVQRLLAEMREHSCEFAVIEASSHGLSTRTARLQDVA
FDVAVCMNVRHEHLEFHGSFEQYRFDKANVFRALDAHDHIKDGRRVPSFG
VLWAEDASAVYFREATHKPCFFFKRGTGAEQRTAACLERMPCTLLWVQTL
PQISQALRLRFVLSTVQEPAQPAQDGAHDVSVPLEGAFNACNIAASFLVL
HGLLGTSLAAFAQHVQYVQPIQGRMQRVDMGQDFEVLIDYAHTPSSFEEI
LPPLAARVRARKRRMLVLFGSAGERDTQKRAMQGAIASRYAHVIVLTDED
PRGEDPMGILCMIAAGCEHKKLGKTLFLIPDRVAALRHIFSLARAQDLVL
LLGKGHEHSIIYAHTVQPYDEERTARELLRASLSSDTLLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGTACCGTAAACCCATTACTGTCTGTCTTGCCTCCTGTTCTGTGCA
AGAAACGCACGGTAGTGCGTGCGACGTTTCTTCCATAGCGTATGATTCAC
GCGCAGTGCGTGAGGGTTCGGTTTTTTTTGCGTTGCGTGGTACGCATGCG
CACGGCGCGCAGTACATCCACGCAGCAATTGATGCCGGCGCCTGCGCAAT
TGTGCATGATTGTCCATTAGATACGTATGTCGTCGGCGTGTACTATGCTC
GTGTACCAGATGCACGGTGTGCGCTTTCTAGTGCTGCTGCAGCTTTCTAC
GATTTTCCTACGCGTGCTTTGACAGTTATCGGGGTCACTGGCACGGAGGG
TAAAAGCAGCACGGTTAGTTTCATTGCGCAGCTTTTGCGTTTATGTGGTA
AACGAGTTGGTTTTATCTCTACTGTGGAGTATTCGTTAGGAGATGATATT
CTCCCGAACGCAGAGCATCAAACCACACCGGAGTCGCTAACAGTACAGCG
GCTCCTCGCTGAGATGCGGGAGCACAGCTGTGAATTTGCAGTAATTGAAG
CGTCGTCCCACGGGCTTTCCACACGTACGGCACGTTTGCAGGATGTTGCA
TTTGATGTGGCAGTATGTATGAACGTACGCCATGAACATTTAGAATTTCA
TGGTTCGTTTGAACAATATCGCTTTGATAAAGCAAATGTATTTCGTGCGC
TAGATGCGCATGATCACATAAAAGACGGACGGCGCGTTCCTTCTTTTGGA
GTACTCTGGGCGGAAGACGCATCGGCTGTGTATTTTCGCGAAGCGACGCA
CAAACCCTGTTTTTTCTTTAAGAGAGGAACCGGCGCTGAGCAAAGGACAG
CAGCCTGCCTGGAAAGGATGCCGTGTACCCTGCTATGGGTGCAAACACTT
CCTCAGATATCTCAGGCCTTGCGATTAAGGTTTGTGTTGTCAACTGTTCA
GGAACCTGCACAACCAGCACAGGACGGAGCACATGATGTATCGGTGCCGC
TTGAAGGAGCTTTCAATGCCTGTAATATAGCAGCGTCTTTTCTTGTACTG
CATGGATTGCTTGGTACGTCGCTTGCGGCTTTTGCACAGCACGTGCAGTA
CGTCCAGCCAATCCAGGGGAGAATGCAGCGTGTGGATATGGGACAGGATT
TTGAGGTGCTCATTGACTATGCGCATACACCCTCTTCCTTCGAGGAGATT
TTGCCACCGCTTGCAGCGCGTGTGCGCGCGCGTAAGAGGCGCATGTTGGT
ATTGTTCGGCTCGGCCGGGGAGCGGGACACGCAAAAGCGTGCAATGCAAG
GCGCAATTGCCTCTCGTTATGCGCACGTAATTGTGCTCACAGATGAGGAT
CCGAGAGGAGAGGATCCAATGGGTATTCTGTGCATGATTGCGGCAGGTTG
TGAGCACAAGAAATTGGGTAAAACCCTGTTTCTGATTCCGGATCGTGTCG
CTGCTCTGCGGCACATATTCTCTCTTGCGCGTGCGCAGGACCTTGTGCTG
CTGCTGGGTAAGGGGCATGAGCATTCAATTATTTATGCGCACACCGTGCA
ACCGTATGATGAAGAACGTACGGCGCGTGAATTATTACGTGCCAGCTTAT
CCTCTGACACCTTACTATCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy