Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-3 tRNA-Ala-2 IGR672 IGR673 IGR674 IGR670 IGR671 IGR669 IGR667 IGR668 TP0923 TP0931 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924 TP0923 TP0931 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924 Type: tandem, Name:  - 206 Type: tandem, Name:  - 207 TP0923 TP0931 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924
* Calculated from Protein Sequence

Gene ID: TP0926

DNA Molecule Name:
1  

Genbank ID:
3323246

Gene Name:
lep  

Definition:
possible signal peptidase I

Gene Start:
1007828

Gene Stop:
1006293

Gene Length:
1536

Molecular Weight*:
57609

pI*:
9.90

Net Charge*:
12.16

EC:
3.4.21.89  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Signal peptidase I is involved in cleaveage of N-terminal leader
sequences from secreted and periplasmic proteins precursor.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal region had few significant hits
to signal peptidase I proteins. For example residues 49-218 are 29%
similar to signal peptidase I of Borrelia burgdorferi,(AE001117).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0681
COG name: Signal peptidase I
Functional Class:  N
The phylogenetic pattern of COG0681 is AmTKYqvCeBrhuj--OLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 64-89, 5-30, 120-135, 175-186, and 441-460 represent
significant (99%) hits to blocks BL00501A,B,C,D, Signal peptidases I
serine proteins. Residues 235-249 represent a significant (96%) hit
to block PR00820B, CBXX/CFQX PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-133 are 30% similar to signal peptidase I of LEP_SALTY.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0185 signal peptidase I.
Residues 69-204 are 29% similar and residues 403-460 are 32% similar
to TP0185.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
62  
84
non-globular  
198  
301

PDB Hit:
none

Gene Protein Sequence:
MVLTLCVCALLFCLRRKYVHLFFPRGVSVHTPPASSDVRSVLPDMPVRRR
RGIFVVLEWVDALTQAACFMLLVNLFAFQLYVIPSESMVPSFMVGDRLLV
FKTASGPVFPLSSFRLPRWRTYKRGDIVVFSNPHYPDTPQDKLRAFLAQL
VYMLTFTRKNINVDPVTGAPKADPLVKRIVALPGEKVMLVDGVLYTKTRH
DAHFKPVAQDRTYATWDLNALPARDLARVQRVIFNAEELAAIHLVERLRA
QVDFRDLAEKTRALVAQAHAYAGAASRTRQGIGVAQPITHTSDIPALPLF
EKEMRGAREITQLFATVADVATHIRDTSQGFAHFAHFVQSWIPFWGQGTY
GLDTGQEGPSLHRAGLSLYQIRFAQLNALVKYTFAQLVVKGLQVTAHRTS
EAGQDETLTTLLQDAARYIFFLGAARGFNMDEFPAGAEQYLPEHNYFMMG
DNRLNSTDMRHAYTEHLEAIDAHDPFPIFFSSNVAPKYIPDSHILGVASF
RFWPPSRIGTPQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTGCTGACTCTGTGTGTCTGTGCGCTGTTGTTTTGCCTGAGGAGGAA
GTACGTACATCTCTTTTTTCCTCGTGGGGTTTCGGTGCACACGCCCCCTG
CGTCTTCGGACGTGCGGAGTGTGTTGCCGGATATGCCAGTGAGAAGGAGG
CGAGGAATCTTTGTCGTACTCGAATGGGTTGACGCGCTCACCCAGGCTGC
GTGTTTCATGCTTTTGGTGAATTTGTTCGCGTTCCAGTTGTACGTTATCC
CGAGCGAATCGATGGTCCCCAGCTTTATGGTCGGCGATAGACTCCTCGTG
TTCAAGACCGCCTCAGGGCCTGTATTCCCGCTTTCTTCGTTTCGTTTGCC
ACGCTGGCGTACCTACAAGCGCGGAGACATCGTCGTTTTTTCCAATCCTC
ATTACCCTGACACTCCGCAGGATAAGCTCCGCGCCTTTTTAGCCCAATTA
GTGTACATGCTCACCTTTACGCGCAAGAACATTAATGTGGATCCTGTCAC
CGGTGCGCCGAAAGCTGATCCTCTCGTCAAACGCATTGTTGCTCTGCCAG
GGGAAAAAGTTATGCTCGTTGACGGTGTGCTCTATACGAAGACCAGGCAT
GATGCGCACTTCAAGCCTGTCGCACAAGACCGTACGTACGCCACGTGGGA
TTTGAATGCGTTGCCCGCACGCGATTTGGCGCGTGTTCAACGGGTCATAT
TTAATGCTGAGGAGCTCGCCGCCATCCATCTGGTAGAGCGCCTGCGCGCC
CAGGTGGATTTTCGCGATTTAGCAGAGAAAACGCGCGCGTTGGTTGCCCA
AGCGCACGCGTACGCGGGGGCGGCGTCACGCACCCGACAGGGCATTGGCG
TGGCGCAACCGATAACGCACACATCTGACATTCCTGCTTTACCTCTGTTT
GAAAAAGAAATGCGCGGGGCGCGGGAGATCACACAGCTCTTCGCCACCGT
TGCAGACGTTGCCACGCATATCCGCGACACCTCCCAGGGGTTCGCCCACT
TCGCTCACTTTGTGCAAAGCTGGATCCCATTTTGGGGGCAAGGAACGTAT
GGCTTGGACACGGGACAGGAAGGTCCGTCCCTGCACCGCGCAGGCCTCTC
GCTCTACCAGATAAGATTTGCGCAGCTGAACGCGTTGGTGAAGTACACGT
TCGCCCAGCTAGTGGTAAAAGGCCTCCAGGTGACAGCACACCGAACGTCG
GAGGCTGGGCAGGACGAAACGCTCACTACACTTTTGCAGGACGCGGCCCG
GTACATCTTTTTCCTGGGTGCGGCGCGTGGATTCAACATGGACGAATTCC
CCGCTGGCGCCGAGCAGTACCTTCCAGAACACAACTACTTCATGATGGGA
GACAACCGATTGAACTCTACTGATATGCGCCACGCGTACACCGAACACCT
CGAGGCAATCGACGCGCACGACCCGTTCCCTATTTTCTTTAGCTCCAATG
TTGCGCCCAAGTACATTCCCGATAGCCACATCCTCGGTGTGGCGTCGTTC
CGATTCTGGCCGCCCTCCCGCATAGGCACCCCACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy