Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-3 tRNA-Ala-2 IGR672 IGR673 IGR666 IGR670 IGR671 IGR669 IGR667 IGR668 TP0922 TP0923 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924 TP0922 TP0923 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924 Type: tandem, Name:  - 206 Type: tandem, Name:  - 207 TP0922 TP0923 lep, - TP0926 fld, - TP0925 TP0927 TP0928 TP0929 TP0930 tex, - TP0924
* Calculated from Protein Sequence

Gene ID: TP0925

DNA Molecule Name:
1  

Genbank ID:
3323245

Gene Name:
fld  

Definition:
flavodoxin

Gene Start:
1005699

Gene Stop:
1006136

Gene Length:
438

Molecular Weight*:
15777

pI*:
4.23

Net Charge*:
-12.94

EC:
1.19.6.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Flavodoxin is a low-potential electron donor to a number of redox enzymes.

There is a 3D structure of this protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to flavodoxins. For
example residues 6-145 are 30% similar to FLAV_CLOBE, flavodoxin
of Clostridium sp.,(J05015).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0716
COG name: Flavodoxins
Functional Class:  C
The phylogenetic pattern of COG0716 is amT----cEB-huj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 67-117 are 50% similar to flavodoxin of FLAV_MEGEL.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 6 to 140 (E-value = 1.5e-27) place TP0925 in the Flavodoxin_1 family which is described as Flavodoxin (PF00258)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
101

PDB Hit:
gi|1941948|pdb|6NUL| Clostridium Beijerinckii Flavodoxin Mutant: N137a Reduced (150k) Electron Transport, Flavoprotein, Fmn Mol_id: 1; Molecule: Flavodoxin; Chain: Null; Engineered: Yes; Mutation: N137a; Biological_unit: Monomer; Other_details: Reduced

Gene Protein Sequence:
MAKVAVIFWSGTGHTETMARCIVEGLNVGGAKADLFSVMDFDVGTFDSYD
RFAFGCSAAGSEELESSEFEPFFTSIEGRLSGKKVALFGSYEWAGEGEGG
EWMVNWVERCKAAGADVFEGKGEIAYDDPSEEAQASCKAFGERFAR

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCAAAAGTTGCTGTCATTTTTTGGAGTGGCACTGGGCACACTGAAAC
GATGGCTCGCTGCATCGTAGAGGGTTTGAATGTCGGTGGTGCAAAAGCTG
ACCTTTTTAGCGTCATGGACTTCGACGTTGGTACTTTTGATTCCTATGAC
CGCTTCGCCTTTGGCTGCTCTGCAGCTGGTTCTGAGGAGCTAGAGTCAAG
CGAGTTTGAACCCTTCTTTACCTCTATTGAGGGAAGGTTATCGGGGAAAA
AAGTTGCGCTTTTCGGATCCTATGAGTGGGCTGGAGAAGGGGAAGGCGGC
GAATGGATGGTCAACTGGGTCGAGCGTTGTAAGGCGGCTGGCGCTGATGT
CTTCGAGGGGAAGGGGGAGATCGCGTACGACGATCCCAGTGAAGAAGCCC
AGGCAAGCTGTAAAGCATTCGGCGAGCGCTTCGCACGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy