Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 IGR661 IGR662 IGR666 IGR664 IGR665 IGR663 IGR667 trx, - TP0919 TP0922 TP0923 TP0918 npe,nox, - TP0921 mgtE, - TP0917 tex, - TP0924 TP0920 trx, - TP0919 TP0922 TP0923 TP0918 npe,nox, - TP0921 mgtE, - TP0917 tex, - TP0924 TP0920 Type: tandem, Name:  - 206 trx, - TP0919 TP0922 TP0923 TP0918 npe,nox, - TP0921 mgtE, - TP0917 tex, - TP0924 TP0920
* Calculated from Protein Sequence

Gene ID: TP0921

DNA Molecule Name:
1  

Genbank ID:
3323238

Gene Name:
npe  nox  

Definition:
NADH oxidase/ NADH peroxidase

Gene Start:
999250

Gene Stop:
1000584

Gene Length:
1335

Molecular Weight*:
48633

pI*:
6.99

Net Charge*:
-0.05

EC:
1.11.1.1  1.6.99.3  

Functional Class:
Energy metabolism; Aerobic  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
NADH oxidase catalyses the four-electron reduction of molecular
oxygen to water.

Reaction:
2 NADH + O(2) = 2 NAD(+) + 2 H(2)O.

NADH peroxidase is a peroxidase whose active site is a redox-active
cysteine-sulfenic acid bond.

Reaction:
NADH + H(2)O(2) = NAD(+) + 2 H(2)O.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to NADH oxidase proteins.
For example residues 2-444 are 59% similar to NADH oxidase of Streptococcus
mutans,(D49951). Residues 1-443 are 36% similar to NAPE_ENTFA, NADH
peroxidase of Enterococcus faecalis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0446
COG name: Uncharacterized NAD(FAD)-dependent dehydrogenases
Functional Class:  R
The phylogenetic pattern of COG0446 is AmtKyQVCE-R---gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 2-24, 150-172, 27-40, 151-165, and 3-17 represent significant
(99%) hits to blocks PR00419A,B,D, ADRENODOXIN REDUCTASE FAMILY
SIGNATURE. Residues 2-17, 150-165, 235-251, 149-167, and 102-120
represent significant (96%) hits to blocks PR00370A,C,D,E, FLAVIN-
CONTAINING MONOOXYGENASE (FMO) SIGNATURE. Residues 148-178 and
418-437 represent significant (95%) hits to blocks BL00067A,C,
3-hydroxyacyl-CoA dehydrogenase proteins.

ProDom Summary:  Protein Domain Search
Residues 106-250 are 42% similar to NADH oxidase of NAOX_ENTFA. Residues
2-89 and 322-443 also support this match. Residues 302-418 are 22%
similar to reductase of MERA_STAAU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 293 (E-value = 6.8e-80) place TP0921 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)
Residues 333 to 434 (E-value = 3.6e-06) place TP0921 in the Pyr_redox_dim family which is described as Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852)

PDB Hit:
gi|494414|pdb|1NPX| Nadh Peroxidase (E.C.1.11.1.1) Non-Active Form With Cys 42 Oxidized To A Sulfonic Acid (Cys42-So3h)

Gene Protein Sequence:
MKIVIIGANHAGTACVNCLTDLTTTNEVVVFDRNNNISFLGCGMALWIGG
QIRGSEGLFYANKEQLEKKGARVSMESDITRIDFASKKVYGTARDGSAIA
ESYDKLIIATGSLPIIPKIDGMDLENVQRIKLFQDAEAVIKKLEQPSIKN
IAVIGAGYIGVELAEAFERHQKKVTLIDAMDSSLSNYYDASFRALMDENL
RSHHITLAFGQKVQKLRGSNGKVVAVVTDKGEYPADMVMVCIGFSPNTAL
GKNEVRTFANGAYAVDLKQETSVKDVYAIGDCATVFDNSLGQTSYIALAT
NAMRSGIVAAHNAAGFPLEGIGVQGSNGINIYDLKMVSTGVTQERAARMG
LEVEVTDFEDSQLPAFMEVDNHPVKIRIVFDKKTRVIVGAQMASRHDMSM
GIHLFSLAIQERVTIDKLKLLDMFFLPHFNKPYNYVTMAALRARS

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGATCGTCATTATCGGAGCGAACCACGCAGGAACCGCCTGTGTCAA
TTGCCTCACAGACCTTACCACCACGAATGAAGTGGTAGTCTTTGACCGTA
ACAATAATATTAGCTTCCTTGGTTGCGGCATGGCTCTTTGGATTGGCGGA
CAAATCCGTGGATCGGAGGGTCTATTCTACGCAAATAAAGAACAATTGGA
AAAAAAGGGTGCACGCGTTTCCATGGAAAGCGATATCACCCGTATCGATT
TTGCCTCAAAAAAGGTGTACGGGACTGCACGAGACGGTTCTGCAATCGCA
GAGTCCTACGACAAGCTTATTATTGCAACCGGTTCTCTGCCTATCATTCC
TAAAATCGACGGCATGGATTTGGAGAATGTTCAGCGCATTAAGCTATTTC
AGGATGCTGAAGCGGTGATTAAAAAACTCGAGCAGCCTTCCATTAAGAAT
ATTGCCGTTATCGGTGCCGGGTACATTGGCGTGGAGCTTGCAGAGGCGTT
TGAGCGCCACCAAAAAAAGGTAACGCTCATCGATGCGATGGACTCTAGTC
TTTCCAATTATTACGACGCATCCTTCCGTGCACTCATGGATGAGAACTTG
CGCAGCCATCACATCACCCTTGCGTTTGGCCAGAAAGTGCAAAAACTCCG
TGGCAGCAATGGAAAGGTAGTGGCAGTGGTGACAGATAAGGGTGAGTACC
CCGCAGACATGGTTATGGTGTGCATTGGCTTTAGCCCCAATACTGCACTG
GGAAAGAACGAGGTGCGAACCTTTGCCAATGGCGCGTATGCGGTAGATTT
AAAACAAGAAACAAGTGTGAAAGACGTGTACGCAATTGGCGATTGTGCAA
CGGTGTTTGACAATTCGCTCGGACAAACTTCTTACATTGCGCTTGCAACC
AATGCGATGCGCAGCGGTATCGTTGCGGCGCACAACGCTGCAGGATTCCC
ACTTGAAGGCATTGGGGTGCAGGGCTCCAACGGTATCAACATATACGACT
TAAAAATGGTGTCCACAGGAGTGACGCAGGAGCGCGCCGCGCGCATGGGA
CTTGAGGTGGAGGTAACGGATTTTGAAGACTCACAGTTACCCGCCTTTAT
GGAAGTGGACAATCACCCGGTGAAAATCCGGATTGTGTTTGATAAAAAAA
CGCGGGTGATTGTGGGCGCTCAAATGGCGTCACGGCACGACATGTCGATG
GGTATTCACCTGTTCTCTCTTGCAATCCAGGAGCGGGTGACCATTGATAA
GTTAAAACTGCTGGACATGTTCTTTCTGCCGCATTTTAACAAGCCGTACA
ACTACGTTACGATGGCGGCCTTGCGTGCGCGCTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy