Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR654 IGR657 IGR656 IGR652 IGR655 IGR659 IGR658 est, - TP0902 TP0901 TP0906 flhB, - TP0911 rpsP, - TP0905 TP0914 TP0907 trmD, - TP0908 TP0910 TP0912 TP0915 murD, - TP0903 est, - TP0902 TP0901 TP0906 flhB, - TP0911 rpsP, - TP0905 TP0914 TP0907 trmD, - TP0908 TP0910 TP0912 TP0915 murD, - TP0903 Type: tandem, Name:  - 205 est, - TP0902 TP0901 flhB, - TP0911 TP0914 TP0907 trmD, - TP0908 TP0910 TP0912 TP0915 murD, - TP0903 TP0904 rplS, - TP0909 TP0913 rplS, - TP0909 rpsP, - TP0905 TP0913 TP0904 TP0906
* Calculated from Protein Sequence

Gene ID: TP0908

DNA Molecule Name:
1  

Genbank ID:
3323221

Gene Name:
trmD  

Definition:
tRNA (guanine-N1)-methyltransferase

Gene Start:
987891

Gene Stop:
988640

Gene Length:
750

Molecular Weight*:
28104

pI*:
6.84

Net Charge*:
-0.82

EC:
2.1.1.31  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Björk GR, Nilsson K.
1-methylguanosine-deficient tRNA of Salmonella enterica serovar Typhimurium affects thiamine metabolism.
J Bacteriol. 2003 Feb;185(3):750-9.
PMID: 12533450

Anantharaman V, Koonin EV, Aravind L.
SPOUT: a class of methyltransferases that includes spoU and trmD RNA methylase superfamilies, and novel superfamilies of predicted prokaryotic RNA methylases.
J Mol Microbiol Biotechnol. 2002 Jan;4(1):71-5.
PMID: 11763972

Persson BC, Bylund GO, Berg DE, Wikström PM.
Functional analysis of the ffh-trmD region of the Escherichia coli chromosome by using reverse genetics.
J Bacteriol. 1995 Oct;177(19):5554-60.
PMID: 7559342

Comment:
This protein is one of several nucleases operating together with the
tRNA-modifying enzymes before the formation of the mature tRNA.
Reaction:
S-ADENOSYL-L-METHIONINE + TRNA =
S-ADENOSYL-L-HOMOCYSTEINE + TRNA CONTAINING N(1)-METHYLGUANINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to tRNA (guanine-N1)-
methyltransferases. For example residues 1-219 are 56% similar to
tRNA (guanine-N1)-methyltransferase of Borrelia burgdorferi,(AE001170).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0336
COG name: tRNA-(guanine-N1)-methyltransferase
Functional Class:? J
The phylogenetic pattern of COG0336 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 21-219 are 46% similar to tRNA (guanine-N1)-methyltransferase
of TRMD_HAEIN.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 22 to 226 (E-value = 6.9e-106) place TP0908 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
134  
151

PDB Hit:
none

Gene Protein Sequence:
MNIDVLTLFPAIPRVYFSTSIMARAVSDGIIHYNIVNIRDFAHDKHKHCD
APPYGGGPGMLMRSEPLGKALDSVDAPKKRVVYVTPSGKLFEQGYARSLA
QERALVLICGRYEGIDQRIIDEYVDDEVCIGNYVLSSGEIAALVLIDAVS
RCVSGVIRHESLEEESFVNSLVEYPQYTRPRCFHNRDVPPVLLSGHHAHI
RTWRLARQIEKTRRNRPDLLSAARASAAWTQEAESLLKELDYELPPHPTN


Gene Nucleotide Sequence:  Sequence Viewer
ATGAACATTGACGTACTGACTCTCTTTCCCGCCATCCCGCGGGTTTATTT
CTCCACCTCAATAATGGCGCGCGCCGTGAGCGACGGGATCATTCACTACA
ATATTGTCAACATCCGTGACTTTGCGCACGACAAACACAAACACTGTGAC
GCCCCGCCCTACGGGGGCGGACCTGGCATGCTCATGCGCTCAGAACCGTT
AGGGAAGGCCCTGGATTCAGTAGACGCTCCCAAAAAGCGCGTCGTGTACG
TCACTCCCTCTGGAAAGCTCTTTGAGCAAGGCTATGCGCGCTCACTCGCA
CAGGAACGTGCCCTCGTGCTCATCTGCGGCAGATACGAGGGAATTGACCA
ACGTATCATAGACGAGTATGTCGACGACGAAGTTTGCATCGGGAACTACG
TTCTCTCCTCAGGAGAGATCGCCGCGCTCGTGCTCATCGATGCGGTGAGC
CGCTGTGTTAGCGGTGTCATCCGCCATGAATCTCTCGAGGAGGAAAGTTT
TGTAAACAGTCTCGTGGAGTACCCGCAGTACACCAGGCCGCGCTGTTTTC
ACAACCGGGACGTTCCCCCTGTACTTCTCTCCGGTCACCACGCGCATATC
CGCACGTGGCGGCTTGCGCGCCAGATCGAAAAAACACGAAGGAATAGACC
TGACCTCCTCAGCGCTGCGCGTGCGTCTGCAGCCTGGACTCAAGAGGCTG
AGTCCCTTCTTAAGGAGTTAGACTATGAGTTGCCACCTCATCCAACAAAT



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy