Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR654 IGR657 IGR656 IGR651 IGR652 IGR655 est, - TP0902 TP0901 TP0900 TP0906 flhB, - TP0911 rpsP, - TP0905 TP0907 trmD, - TP0908 TP0910 TP0912 murD, - TP0903 est, - TP0902 TP0901 TP0900 TP0906 flhB, - TP0911 rpsP, - TP0905 TP0907 trmD, - TP0908 TP0910 TP0912 murD, - TP0903 Type: tandem, Name:  - 204 Type: tandem, Name:  - 205 Type: tandem, Name:  - 276 est, - TP0902 TP0901 TP0900 TP0907 trmD, - TP0908 TP0910 TP0912 murD, - TP0903 TP0904 rplS, - TP0909 rplS, - TP0909 rpsP, - TP0905 flhB, - TP0911 TP0904 TP0906
* Calculated from Protein Sequence

Gene ID: TP0903

DNA Molecule Name:
1  

Genbank ID:
3323217

Gene Name:
murD  

Definition:
UDP-N-acetylmuramoylalanine--D-glutamate ligase

Gene Start:
984880

Gene Stop:
986475

Gene Length:
1596

Molecular Weight*:
57837

pI*:
7.28

Net Charge*:
2.70

EC:
6.3.2.9  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Metabolism of complex carbohydrates; Peptideglycan biosynthesis

Comment:
Reaction:
ATP + UDP-N-ACETYLMURAMOYL-L-ALANINE + D-GLUTAMATE =
ADP + ORTHOPHOSPHATE + UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and C-termnial regions had
significant hits to UDP-N-acetylmuramoylalanine--D-glutamate ligase.
For example residues 37-232 are 37% similar and residues 380-527 are
38% similar to UDP-N-acetylmuramoylalanine--D-glutamate ligase of
Borrelia burgdorferi,(AE001160).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0771
COG name: UDP-N-acetylmuramoylalanine-D-glutamate ligase
Functional Class:  M
The phylogenetic pattern of COG0771 is --T--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 79-244 are 29% similar to UDP-N-acetylmuramoylalanine--
D-glutamate ligase of MURD_BACSU. Residues 119-274 are 30% similar
to UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
of MURE_PSEAE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 53 to 344 (E-value = 1.6e-06) place TP0903 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 391 to 465 (E-value = 2.8e-08) place TP0903 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
94  
175
non-globular  
323  
373
non-globular  
409  
532

PDB Hit:
none

Gene Protein Sequence:
MEQARALLQGKTVTIMGLGVHGGGCAAACFCAEAGARLTVTDLRNADALT
PSLKRLRAYPSIRFTLGEHRLEDFENAHVVIKNPIVKGAHNIYLSAAQRA
GARIETDISLFLRLSPAPLLAVSGSKGKSSTASALCYSLRALGFPAFLGG
NSTVSPLEFVRHTTPATPVVLELSSWQLADLRAVDAQDHTVHHAGLLRPE
IAIMTPIMADHQNWYADMESYVADKQVLYAHQGTHDTLLCNADDGWGPRF
ACEAQKNGVRVFWYTAQSPETACRACTPRLMERALWRATDGTYWARFAEG
DRACMLIPPQLHVPGRVLQTQVASAALAALLFAQRHSLPPSSCPPCFCAH
SHSPAYANHASPPDYACPSAHSPFQEHTRRLAQALESYTGIEHRLEFFYE
KGGLRFYNDSASTVPEATIAALEAFDESVVLIVGGTDKNADYQPLAQAAA
KAHALYLLAGSATARLQPLLHAAQVPFYGPFTSLEVLLQDLRARQKSPGV
IVFSPGAASFELFAHEFERGTTFKSQVRIIFE

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAGCAGGCGCGCGCACTTCTTCAAGGCAAAACGGTAACCATCATGGG
CCTCGGCGTGCACGGCGGGGGCTGCGCGGCAGCCTGCTTTTGTGCAGAAG
CGGGAGCGCGCCTTACGGTTACCGACCTGCGAAATGCTGATGCGCTTACC
CCTTCCCTGAAAAGACTTCGTGCGTACCCGTCCATCCGCTTTACGCTCGG
TGAACACCGGCTGGAAGATTTTGAAAACGCGCATGTTGTCATCAAAAATC
CCATCGTGAAGGGTGCACACAACATCTACCTTTCCGCTGCTCAACGCGCC
GGCGCGCGCATCGAAACGGATATCTCCCTTTTCCTACGCCTTTCTCCCGC
CCCGCTGCTAGCAGTAAGCGGCAGCAAGGGAAAATCCTCCACTGCCAGCG
CCCTGTGCTACAGCTTGCGTGCGCTGGGTTTCCCCGCCTTTCTAGGGGGG
AATAGCACAGTCAGCCCGCTGGAATTTGTGCGTCACACAACGCCTGCAAC
ACCAGTGGTTCTGGAACTGTCGAGCTGGCAGCTTGCAGACCTACGCGCAG
TCGATGCACAGGACCACACTGTACACCACGCCGGTCTGCTGCGCCCGGAG
ATTGCCATCATGACTCCCATTATGGCTGACCATCAAAACTGGTATGCGGA
TATGGAAAGCTACGTGGCAGACAAACAGGTGCTATACGCACACCAGGGAA
CGCACGATACACTGCTGTGTAACGCAGATGACGGGTGGGGACCCCGCTTT
GCCTGCGAAGCGCAGAAAAACGGAGTGCGCGTCTTTTGGTATACGGCCCA
GTCGCCTGAGACCGCTTGCCGCGCGTGCACCCCGCGCCTCATGGAGAGAG
CTCTATGGAGAGCGACGGACGGAACCTACTGGGCACGTTTTGCAGAAGGT
GACCGCGCCTGCATGCTCATCCCACCGCAGCTGCACGTACCGGGCCGTGT
CCTCCAAACGCAAGTGGCGAGTGCAGCGCTTGCAGCGCTCCTGTTCGCGC
AGCGGCATTCTCTACCTCCTTCCTCCTGCCCCCCGTGTTTTTGCGCACAC
TCCCATTCCCCCGCGTACGCGAATCACGCGTCCCCCCCAGACTACGCTTG
TCCGTCCGCTCACAGTCCCTTCCAAGAGCACACCCGGCGTCTTGCACAAG
CGCTGGAGTCCTACACGGGCATCGAACACCGACTAGAGTTTTTTTACGAA
AAGGGGGGACTGCGTTTTTATAACGATTCTGCATCCACTGTACCTGAGGC
AACAATTGCAGCGCTGGAAGCCTTTGATGAAAGCGTGGTTCTTATCGTTG
GCGGCACTGATAAGAATGCAGACTACCAACCCTTGGCACAGGCAGCAGCC
AAGGCGCACGCATTGTACTTGCTTGCAGGAAGTGCTACGGCACGGTTGCA
ACCACTTCTTCATGCAGCACAGGTACCTTTTTACGGACCGTTTACTTCCC
TTGAGGTACTCCTGCAGGATCTCCGGGCGCGGCAGAAAAGCCCAGGCGTG
ATCGTGTTCTCTCCTGGGGCAGCGAGTTTTGAACTTTTCGCCCACGAGTT
TGAGCGAGGTACTACCTTTAAATCCCAGGTGCGTATCATTTTTGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy