Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR645 IGR644 IGR647 IGR643 IGR648 IGR646 rpsO, - TP0887 dut, - TP0885 TP0893 ribF, - TP0888 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rpsO, - TP0887 dut, - TP0885 TP0893 ribF, - TP0888 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rpsO, - TP0887 dut, - TP0885 TP0893 ribF, - TP0888 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rbfA, - TP0890 rbfA, - TP0890
* Calculated from Protein Sequence

Gene ID: TP0890

DNA Molecule Name:
1  

Genbank ID:
3323207

Gene Name:
rbfA  

Definition:
ribosome-binding factor A

Gene Start:
967772

Gene Stop:
967395

Gene Length:
378

Molecular Weight*:
14111

pI*:
10.98

Net Charge*:
11.37

EC:
 

Functional Class:
Translation; General  

Pathway: pathway table

Secondary Evidence:
Huang YJ, Swapna GV, Rajan PK, Ke H, Xia B, Shukla K, Inouye M, Montelione GT.
Solution NMR structure of ribosome-binding factor A (RbfA), a cold-shock adaptation protein from Escherichia coli.
J Mol Biol. 2003 Mar;327(2):521-36.
PMID: 12628255

Swapna GV, Shukla K, Huang YJ, Ke H, Xia B, Inouye M, Montelione GT.
Resonance assignments for cold-shock protein ribosome-binding factor A (RbfA) from Escherichia coli.
J Biomol NMR. 2001 Dec;21(4):389-90.
PMID: 11824762

Bylund GO, Wipemo LC, Lundberg LA, Wikström PM.
RimM and RbfA are essential for efficient processing of 16S rRNA in Escherichia coli.
J Bacteriol. 1998 Jan;180(1):73-82.
PMID: 9422595

Comment:
This protein associates with free 30S ribosomal subunits (but not with
30S subunits that are part of 70S ribosomes or polysomes). It is
essential for efficient processing of 16S rRNA and may interact with
the 5' terminal helix region of 16S rRNA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ribosome-binding
factor A. For example residues 7-118 are RBFA_BACSU, ribosome-binding
factor A of Bacillus subtilis,(Z99112).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0858
COG name: Ribosome-binding factor A
Functional Class:? J
The phylogenetic pattern of COG0858 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 8-106 are 39% similar to ribosome-binding factor A of
RBFA_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 8 to 113 (E-value = 4.9e-59) place TP0890 in the RBFA family which is described as Ribosome-binding factor A (PF02033)

PDB Hit:
none

Gene Protein Sequence:
MKQVSQLRVRKLGEHIRAEIAQLIMLGKIKDPRVSPFLSVNWVDVSGGMV
CARVYVSSFMGKYKTKQGVQGLESAAGFIRSVLAKKLRLRQCPRLSFVYD
ESVRDGFSLSRKIDRLESGGVQTEHA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAGGTAAGTCAGTTAAGGGTGCGCAAATTGGGGGAGCATATCCG
CGCAGAAATAGCGCAGCTTATTATGCTCGGCAAAATAAAGGATCCACGTG
TTTCTCCCTTTCTCTCTGTGAATTGGGTGGATGTGTCTGGGGGGATGGTC
TGTGCGCGGGTATATGTGTCGAGTTTTATGGGTAAGTACAAAACGAAGCA
GGGAGTGCAAGGCTTAGAAAGCGCGGCAGGTTTTATTCGCTCTGTCTTGG
CTAAGAAACTCCGTCTGCGGCAGTGTCCGCGTCTTAGCTTTGTGTATGAC
GAGAGTGTGAGGGATGGATTTTCTCTTTCGAGAAAAATAGATCGGTTAGA
ATCCGGCGGTGTGCAGACTGAGCATGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy