Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR645 IGR644 IGR642 IGR643 IGR646 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 Type: tandem, Name:  - 197 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rbfA, - TP0890 rbfA, - TP0890
* Calculated from Protein Sequence

Gene ID: TP0889

DNA Molecule Name:
1  

Genbank ID:
3323206

Gene Name:
truB  

Definition:
tRNA pseudouridine 55 synthase

Gene Start:
967414

Gene Stop:
966317

Gene Length:
1098

Molecular Weight*:
39458

pI*:
9.29

Net Charge*:
15.50

EC:
5.4.99.12  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Kinghorn SM, O'Byrne CP, Booth IR, Stansfield I.
Physiological analysis of the role of truB in Escherichia coli: a role for tRNA modification in extreme temperature resistance.
Microbiology. 2002 Nov;148(Pt 11):3511-20.
PMID: 12427942

Gutgsell N, Englund N, Niu L, Kaya Y, Lane BG, Ofengand J.
Deletion of the Escherichia coli pseudouridine synthase gene truB blocks formation of pseudouridine 55 in tRNA in vivo, does not affect exponential growth, but confers a strong selective disadvantage in competition with wild-type cells.
RNA. 2000 Dec;6(12):1870-81.
PMID: 11142385

Comment:
This protein is involved in the formation of pseudouridine in the
anticodon stem and loop of tRNAs.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to tRNA pseudouridine
55 synthase. For example residues 6-229 are 34% similar to tRNA
pseudouridine 55 synthase of Borrelia burgdorferi,(AE001179).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0130
COG name: Pseudouridine synthase
Functional Class:? J
The phylogenetic pattern of COG0130 is amtkYqvcebrh----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 36-92 are 49% similar to tRNA pseudouridine 55 synthase of
TRUB_SYNY3. Residues 187-238 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 26 to 176 (E-value = 3.9e-29) place TP0889 in the TruB_N family which is described as TruB family pseudouridylate synthase (N terminal domain) (PF01509)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
64
non-globular  
127  
239

PDB Hit:
none

Gene Protein Sequence:
MCRLSMPDAIVPFAKVSGLTSFAALAQVRRLLGVKKVGHTGTLDRFADGL
LLLLVGGFTKLAPVMTRLEKSYEARIQFGVQTDTLDPEGAVVRCSLFPTF
ARVRAALPHFTGSIDQVPPEYSALKFGGVRASDRVRRGEAVCMKARRVFV
FDLQVLGCEADLGEFKKTQAGRGAAIADLDLTRVRAVTLYVRCSAGFYVR
ALARDIAAACGSCAYVSHLRRTRIGPFDLAQAAGVSRLGSWTWGKERASC
GAACFDVGAPPPPSSGGVATDSVSFGCEDLTVREIKQAVVSCDVDFANRI
GLTACSVHAQYASRFLHGERIRACWFQSFGTRRPGERALVFSEGRCLGLI
RKAANGFSYDAVFCTE

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGCAGACTGAGCATGCCTGACGCTATTGTTCCTTTCGCAAAGGTTTC
CGGTCTTACGAGTTTTGCGGCACTGGCACAGGTCAGGCGTCTTCTGGGAG
TAAAAAAGGTAGGGCATACGGGGACGCTTGATCGCTTTGCTGATGGGCTG
CTGTTGCTTTTGGTAGGGGGCTTTACCAAACTCGCGCCGGTGATGACTCG
CTTGGAAAAGAGTTACGAGGCTCGTATCCAGTTTGGGGTACAAACAGACA
CTCTAGATCCGGAGGGGGCTGTCGTGCGGTGCTCCTTGTTCCCAACATTT
GCGCGCGTGCGTGCGGCGCTGCCTCACTTCACTGGGAGTATTGATCAGGT
GCCGCCTGAATATTCGGCGCTAAAATTCGGAGGTGTGCGTGCGTCCGACC
GGGTGCGGCGTGGGGAAGCAGTGTGCATGAAGGCTCGGCGTGTGTTCGTC
TTTGACTTGCAGGTACTAGGTTGCGAGGCGGATCTGGGTGAATTCAAAAA
GACGCAGGCGGGGAGGGGGGCTGCGATTGCTGATCTTGATCTGACGCGCG
TGCGTGCTGTAACGCTGTACGTACGTTGTTCGGCAGGCTTCTACGTGCGT
GCACTTGCGCGCGACATAGCAGCCGCTTGCGGCTCTTGCGCGTATGTTTC
ACATTTACGGAGAACACGCATTGGACCCTTTGATCTTGCACAGGCGGCGG
GTGTGTCTCGTCTCGGGTCCTGGACATGGGGCAAAGAGCGTGCGTCTTGC
GGTGCCGCTTGCTTTGATGTGGGTGCTCCACCGCCTCCGTCCTCAGGCGG
CGTGGCGACCGATTCAGTCTCTTTCGGGTGTGAAGACTTGACGGTGCGTG
AGATTAAGCAGGCAGTGGTTAGCTGTGATGTGGACTTTGCGAATCGTATT
GGACTTACGGCGTGTTCAGTGCATGCGCAGTATGCGTCGCGGTTTTTGCA
TGGGGAAAGAATACGCGCATGTTGGTTCCAGTCGTTTGGTACGCGAAGGC
CCGGGGAACGTGCGTTGGTGTTTTCCGAGGGTCGCTGTCTTGGATTAATA
AGGAAAGCGGCGAATGGGTTTTCGTATGATGCGGTATTTTGTACGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy