Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR645 IGR644 IGR641 IGR642 IGR643 IGR646 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 TP0883 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 TP0883 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 Type: tandem, Name:  - 195 Type: tandem, Name:  - 196 Type: tandem, Name:  - 197 rpsO, - TP0887 dut, - TP0885 ribF, - TP0888 TP0884 TP0883 truB, - TP0889 nusA, - TP0892 pnp, - TP0886 infB, - TP0891 rbfA, - TP0890 rbfA, - TP0890
* Calculated from Protein Sequence

Gene ID: TP0888

DNA Molecule Name:
1  

Genbank ID:
3323205

Gene Name:
ribF  

Definition:
riboflavin kinase/ FMN adenylyltransferase

Gene Start:
966310

Gene Stop:
965486

Gene Length:
825

Molecular Weight*:
30097

pI*:
8.96

Net Charge*:
10.45

EC:
2.7.1.26  2.7.7.2  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Solovieva IM, Kreneva RA, Leak DJ, Perumov DA.
The ribR gene encodes a monofunctional riboflavin kinase which is involved in regulation of the Bacillus subtilis riboflavin operon.
Microbiology. 1999 Jan;145 ( Pt 1):67-73.
PMID: 10206712

Mack M, van Loon AP, Hohmann HP.
Regulation of riboflavin biosynthesis in Bacillus subtilis is affected by the activity of the flavokinase/flavin adenine dinucleotide synthetase encoded by ribC.
J Bacteriol. 1998 Feb;180(4):950-5.
PMID: 9473052

Comment:
Reaction:
ATP + RIBOFLAVIN = ADP + FMN.

Reaction:
ATP + FMN = DIPHOSPHATE + FAD.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to riboflavin kinase/
FMN adenylyltransferases. For example residues 16-235 are 26% similar
to RIBF_ECOLI, riboflavin kinase/FMN adenylyltransferase of E. coli,
(AE000113).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0196
COG name: FAD synthase
Functional Class:? H
The phylogenetic pattern of COG0196 is ----yqvceBrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 173-202 and 38-51 represent significant (95%) hits to blocks
BL00205B,D, Transferrins proteins. Residues 174-187 and 33-49 represent
significant hits to blocks BL00411A,B, Kinesin motor domain proteins.

ProDom Summary:  Protein Domain Search
Residues 20-118 are 28% similar to YAAC_ECOLI, a hypothetical protein
with similarity to riboflavin kinase.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 19 to 173 (E-value = 4.4e-43) place TP0888 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
73
transmembrane  
111  
128
non-globular  
204  
275

PDB Hit:
none

Gene Protein Sequence:
MRIFRWSQLQEGACIACDRGAAISVGGFDGPHRGHAFLFDKVFAAACAPV
ADRARCTGLITFTHPPRKHKTSSYEGDLSTLRLRLRYFRARGFDFVVLID
FSKDFARIPGGVFFNTLLRAVRVCYLAVGVDFRCGHGLDTGVRELRRLGD
AHSFVCDAVGHYTLEGVRVSSSAVRRAVRCADFESARRLLGRAFSLDGEV
IPWQQSGGCARTLCAERGRVSQTLPPEGEYAVRLVQGSGVGLRAQLSVGS
SLVQLRLGTEALSHGREALDSIEFE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCATTTTTCGTTGGTCTCAGTTGCAGGAGGGTGCATGTATAGCGTG
TGATCGGGGAGCAGCAATATCGGTGGGGGGGTTTGACGGTCCTCACCGGG
GACATGCTTTTCTCTTCGATAAGGTGTTTGCCGCTGCGTGCGCTCCTGTG
GCCGATCGGGCGCGGTGCACCGGGCTGATCACCTTTACTCATCCTCCCAG
GAAGCACAAAACCTCTTCTTACGAGGGGGATCTGTCAACGCTGCGTTTGC
GACTCCGTTATTTTCGTGCGCGCGGCTTTGATTTCGTCGTGCTCATTGAC
TTTTCCAAGGATTTTGCTAGAATCCCGGGTGGTGTCTTCTTCAACACCCT
GTTGCGTGCAGTGAGGGTGTGCTACCTCGCAGTTGGTGTCGACTTTCGGT
GTGGACATGGGCTGGACACCGGGGTCCGTGAGCTGCGTCGGCTTGGTGAT
GCGCATAGCTTTGTCTGCGACGCGGTGGGTCACTACACTCTCGAGGGAGT
TCGGGTGAGTTCGAGCGCGGTACGCCGTGCGGTGCGCTGCGCAGACTTTG
AGAGCGCGCGGCGTCTGCTGGGGCGTGCGTTTTCGCTTGACGGGGAGGTA
ATTCCCTGGCAGCAGAGCGGGGGGTGTGCCCGCACGTTGTGCGCCGAGCG
TGGGCGTGTGAGTCAGACGCTTCCACCTGAGGGCGAGTATGCGGTACGCC
TTGTACAGGGGAGTGGGGTGGGTCTGCGTGCGCAGCTTAGTGTGGGTTCC
TCTCTCGTGCAGCTGAGGCTCGGTACCGAGGCGCTGTCGCATGGGCGGGA
GGCGCTTGACTCTATCGAGTTCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy