Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR645 IGR644 IGR641 IGR642 IGR640 IGR643 rpsO, - TP0887 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 truB, - TP0889 TP0882 pnp, - TP0886 rpsO, - TP0887 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 truB, - TP0889 TP0882 pnp, - TP0886 Type: tandem, Name:  - 197 Type: tandem, Name:  - 194 Type: tandem, Name:  - 195 Type: tandem, Name:  - 196 rpsO, - TP0887 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 truB, - TP0889 TP0882 pnp, - TP0886 rbfA, - TP0890 TP0880 TP0883 rbfA, - TP0890 TP0883 TP0880
* Calculated from Protein Sequence

Gene ID: TP0885

DNA Molecule Name:
1  

Genbank ID:
3323202

Gene Name:
dut  

Definition:
deoxyuridine 5'-triphosphate nucleotidohydrolase

Gene Start:
962945

Gene Stop:
962508

Gene Length:
438

Molecular Weight*:
15360

pI*:
8.43

Net Charge*:
1.42

EC:
3.6.1.23  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Caradonna S, Muller-Weeks S.
The nature of enzymes involved in uracil-DNA repair: isoform characteristics of proteins responsible for nuclear and mitochondrial genomic integrity.
Curr Protein Pept Sci. 2001 Dec;2(4):335-47.
PMID: 12369930

McClure MA.
Evolution of the DUT gene: horizontal transfer between host and pathogen in all three domains of life.
Curr Protein Pept Sci. 2001 Dec;2(4):313-24.
PMID: 12369928

Persson R, Nord J, Roth R, Nyman PO.
dUTPase from Escherichia coli; high-level expression and one-step purification.
Prep Biochem Biotechnol. 2002 May;32(2):157-72.
PMID: 12071646

Wang L, Weiss B.
dcd (dCTP deaminase) gene of Escherichia coli: mapping, cloning, sequencing, and identification as a locus of suppressors of lethal dut (dUTPase) mutations.
J Bacteriol. 1992 Sep;174(17):5647-53.
PMID: 1324907

Comment:
This enzyme is involved in nucleotide metabolism. It produces dUMP,
the immediate precursor of thymidine nucleotides and it decreases
the intracellular concentration of dUTP so that uracil cannot be
incorporated into DNA.

Reaction:
DUTP + H(2)O = DUMP + PYROPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to deoxyuridine
5'-triphosphate nucleotidohydrolase. For example residues 15-144
are 58% similar to deoxyuridine 5'triphosphate nucleotidohydrolase
of Aquifex aeolicus,(AE000679).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0756
COG name: dUTPase
Functional Class:? F
The phylogenetic pattern of COG0756 is ----yq--eBrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 45-144 are 41% similar to deoxyuridine 5'-triphosphate
nucleotidohydrolase of DUT_CANAL. Residues 15-78 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 10 to 144 (E-value = 2e-14) place TP0885 in the dUTPase family which is described as dUTPase (PF00692)

PDB Hit:
gi|1311150|pdb|1DUP|A Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase (D-Utpase) Hydrolase, Nucleotide Metabolism Mol_id: 1; Molecule: Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain: A; Synonym: D-Utpase; Ec: 3.6.1.23

Gene Protein Sequence:
MIRVRAVVYPGASFPEYQTLGSSGADLRAFLPGGPLEVHPLGRVLVPTGV
CVELPVGLEMQIRPRSGLALEYGVTVLNSPGTIDADYRGEIRVLLVNLGL
AAFVVSHGDRIAQAVISSVLRVEYVRSGSISLTERGKGGYGSTGVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCCGTGTGCGAGCTGTCGTGTATCCGGGAGCTTCTTTTCCCGAGTA
CCAGACGTTAGGCTCAAGTGGAGCCGATTTGCGGGCCTTTCTTCCCGGAG
GACCGCTTGAGGTTCATCCCCTGGGCCGGGTTCTCGTCCCCACGGGTGTT
TGTGTGGAGCTTCCTGTGGGGTTGGAGATGCAAATTCGTCCCCGCTCTGG
GTTAGCACTCGAATACGGAGTGACGGTTTTAAATTCCCCGGGAACGATAG
ACGCTGACTACCGGGGGGAAATACGCGTGTTGCTTGTCAACCTTGGGCTA
GCTGCTTTCGTAGTCTCCCATGGAGATCGTATCGCGCAGGCGGTGATTTC
TTCTGTGCTCCGTGTTGAATATGTGCGCTCCGGTAGTATCTCGCTGACTG
AACGGGGAAAAGGAGGGTACGGATCCACAGGGGTTCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy