Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR644 IGR641 IGR642 IGR640 IGR643 rpsO, - TP0887 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 TP0879 TP0882 pnp, - TP0886 rpsO, - TP0887 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 TP0879 TP0882 pnp, - TP0886 Type: tandem, Name:  - 197 Type: tandem, Name:  - 194 Type: tandem, Name:  - 195 Type: tandem, Name:  - 196 dut, - TP0885 TP0881 ribF, - TP0888 TP0884 TP0879 TP0882 pnp, - TP0886 TP0880 TP0883 TP0880 TP0883 rpsO, - TP0887
* Calculated from Protein Sequence

Gene ID: TP0883

DNA Molecule Name:
1  

Genomic Island ID:
4

Genbank ID:
3323200

Gene Name:


Definition:
conserved hypothetical protein (integral membrane)

Gene Start:
961369

Gene Stop:
960275

Gene Length:
1095

Molecular Weight*:
42111

pI*:
8.25

Net Charge*:
6.69

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed three significant hits to hypothetical proteins.
For example residues 10-344 are 20% similar to B. burgdorferi predicted
coding region BB0808,(AE001179).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0795
COG name: Predicted permeases
Functional Class:  R
The phylogenetic pattern of COG0795 is ------vCE--HUJ--OLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0884, also a conserved
hypothetical integral membrane protein. Residues 9-179 are 22%
similar to TP0884.

Pfam Summary:  Pfam Search
Residues 3 to 352 (E-value = 6.3e-80) place TP0883 in the YjgP_YjgQ family which is described as Predicted permease YjgP/YjgQ family (PF03739)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
22
transmembrane  
39  
73
transmembrane  
81  
114
transmembrane  
292  
311
transmembrane  
325  
348

PDB Hit:
none

Gene Protein Sequence:
MLDMFLPIFFLVLVCASMILDAIDILVNLTQFISNGYRFSSLVKIWYVSI
PHYVLLCCPLSVLFAATYTVRILYVQNEFLAIHFGGLSFFSIVGPWFGFM
CFLAIGIFAFDNSVVVVSQSKKDEIIARTVSYAQGNSENDVVASSFDGKI
ISIAGAYHRGQKVLVDMLVIMKNSNGTIQKLIEAHTAHWQKDRWVLIKPV
VYTITHEMKLMVSEYLDSFELREPLELFDHQDFLTKGMSIQKIKETLHTL
KYASKPHRELSIRFYKKFYFPLTMCIMLCLSFLTGSFLKKRSLIMYIFCS
VVLASAYYVVEMTSIVCAREEYFSPFWGVFFPVLTFLFLIFYVWCAGFMQ
ERQYRASSLRQSVCL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGACATGTTCTTACCAATTTTTTTTCTAGTGCTCGTGTGTGCGAG
TATGATTCTCGATGCTATTGATATTCTGGTTAATCTTACGCAGTTTATTT
CGAATGGGTATCGTTTTTCTTCTTTGGTGAAGATATGGTATGTATCTATC
CCACATTATGTACTGCTGTGCTGTCCTTTGTCTGTGCTTTTTGCTGCAAC
GTATACTGTGCGAATCTTGTATGTCCAAAATGAATTTCTTGCCATCCATT
TCGGTGGGTTATCTTTTTTTAGTATCGTAGGCCCGTGGTTTGGTTTTATG
TGTTTCTTAGCAATTGGAATATTTGCATTTGACAATAGTGTGGTAGTTGT
TTCTCAGTCAAAAAAGGATGAAATCATTGCACGTACTGTGAGCTATGCTC
AGGGGAATAGTGAAAATGACGTTGTTGCTTCTTCTTTTGATGGTAAGATA
ATCTCCATTGCGGGTGCGTATCACAGAGGACAAAAGGTGCTCGTTGATAT
GTTAGTTATTATGAAAAATAGTAACGGTACTATTCAGAAGCTTATCGAAG
CACACACTGCACATTGGCAGAAAGACAGGTGGGTTCTTATAAAACCGGTT
GTATATACTATCACTCATGAAATGAAACTTATGGTTTCTGAATATCTTGA
TTCTTTCGAGTTGAGAGAACCGCTTGAATTATTTGATCATCAGGATTTTT
TAACAAAAGGKATGTCCATCCAGAAAATAAAAGAGACGCTTCATACGTTA
AAATATGCGTCAAAGCCTCATAGAGAGTTGTCAATCCGATTCTACAAGAA
ATTTTATTTTCCTCTTACGATGTGCATTATGCTCTGTTTGTCCTTTTTGA
CAGGTTCTTTTCTAAAAAAGAGATCGCTCATCATGTACATCTTTTGTAGT
GTAGTCCTTGCAAGCGCATACTATGTTGTTGAAATGACGAGTATCGTCTG
TGCGAGGGAAGAATATTTTTCTCCATTTTGGGGAGTGTTTTTTCCCGTCT
TGACGTTTTTGTTTTTGATCTTTTACGTGTGGTGTGCTGGATTCATGCAG
GAAAGACAGTATCGTGCATCTTCGCTCAGACAGTCCGTCTGTCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy