Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR637 IGR639 IGR638 IGR641 IGR642 IGR640 dut, - TP0885 TP0881 TP0878 TP0884 TP0879 TP0882 pnp, - TP0886 TP0876 TP0877 dut, - TP0885 TP0881 TP0878 TP0884 TP0879 TP0882 pnp, - TP0886 TP0876 TP0877 Type: tandem, Name:  - 195 Type: tandem, Name:  - 192 Type: tandem, Name:  - 197 Type: tandem, Name:  - 193 Type: tandem, Name:  - 194 Type: tandem, Name:  - 196 dut, - TP0885 TP0881 TP0878 TP0884 TP0879 TP0882 pnp, - TP0886 TP0880 TP0883 TP0880 TP0883 TP0877 TP0876
* Calculated from Protein Sequence

Gene ID: TP0881

DNA Molecule Name:
1  

Genomic Island ID:
4

Genbank ID:
3323192

Gene Name:


Definition:
ABC transporter, ATP-binding protein

Gene Start:
958725

Gene Stop:
957922

Gene Length:
804

Molecular Weight*:
30030

pI*:
8.17

Net Charge*:
6.04

EC:
 

Functional Class:
Transport and binding proteins; General  

Pathway: pathway table

Comment:
TP0880 may be an associated MSD protein.

Please go to...
http://www.stdgen.lanl.gov

ABC transporters

Treponema pallidum

Data table
NBD Amino Acid Alignment
NBD Organization
Plasma membrane Organization

for a complete listing of Treponema pallidum ABC transporters,
alignments of transporters, nucleotide binding domain organization,and plasma membrane organization.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ABC transporter, ATP-binding proteins. For example residues 3-217 are 33% similar to NATA_BACSU, Na+ ABC transporter, ATP-binding protein of Bacillus subtilis,(Z99105).

COGS Summary:  COGS Search
BeTs to 12 clades of COG1131
COG name: ABC-type multidrug transport system, ATPase component
Functional Class:  R
The phylogenetic pattern of COG1131 is AmTKy-VCEBR-uJ-pol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 37-48 and 137-168 represent significant (99%) hits to blocks BL00211A,B, ABC transporters family proteins. Residues 35-50 and 43-57 represent significant (98%) hits to blocks PR00364A,C, DISEASE RESISTANCE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 119-209 are 31% similar to YE70_HAEIN, a hypothetical protein with similarity to ABC transporter, ATP-binding proteins.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0786, TP0652, TP0120,
TP0142, TP0804, TP0581, TP0321, TP0964, TP0685, TP0164,
TP0838, TP0227, TP0035, TP0300, TP0611, all of which are ABC
transporter, ATP-binding protein. Scores ranged from 44-106 with the match to itself receiving a score of 543.

Pfam Summary:  Pfam Search
Residues 33 to 211 (E-value = 2.1e-49) place TP0881 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
none

Gene Protein Sequence:
MEVLRVTSLTKHYGSRRHPVRGCEDVTFCVERGQVCGILGLNGAGKSTVL
RVIGGLIHPSSGEVYACHCSLSRYPVGYRRHIGVLHEQNPLYADMTVEQH
ILFVARIFQLADGEARTAEMIELFQLQSVAHRRVRNLSKGYKQRVGLAQA
LVHRPKLLVLDEPLSGLDIVYLKEFHKEIVAQNNNLAVVFSTHAVQEIEA
LCDVFVLLHAGHVLFSGNRAQIAARIVREFPEKKQTVALHLETGTFIAFV
FEQYMQWQSAQDAACYAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGTACTTCGTGTAACCAGTTTAACGAAACATTATGGCTCCAGGCG
CCATCCGGTACGTGGGTGTGAAGACGTAACCTTTTGTGTTGAAAGGGGAC
AGGTGTGCGGGATATTGGGGTTGAACGGTGCAGGGAAAAGCACTGTACTT
CGCGTGATTGGTGGGTTGATTCATCCGTCTTCGGGGGAAGTGTATGCGTG
TCATTGTTCTTTATCACGCTACCCGGTAGGGTATCGGCGTCATATTGGTG
TTCTGCATGAGCAGAATCCGCTATACGCAGATATGACGGTTGAGCAACAT
ATTCTTTTTGTTGCCCGCATATTTCAACTTGCCGATGGGGAGGCACGCAC
CGCTGAAATGATAGAATTATTCCAGTTGCAGTCTGTTGCACACAGACGTG
TGCGCAATCTTTCTAAAGGATATAAACAGAGGGTTGGGCTTGCGCAGGCA
TTGGTACACCGTCCCAAACTCCTTGTCTTAGATGAGCCTCTTTCTGGTTT
GGATATTGTATATCTGAAGGAATTCCATAAAGAGATTGTTGCGCAAAACA
ATAATCTTGCTGTGGTGTTTTCTACGCACGCGGTGCAGGAGATCGAAGCG
TTGTGCGACGTGTTTGTCTTATTGCATGCAGGACATGTTCTTTTCTCAGG
AAATAGAGCGCAAATAGCAGCGCGCATCGTGCGAGAATTTCCTGAGAAAA
AGCAAACAGTAGCATTGCACCTTGAAACAGGAACCTTTATCGCTTTTGTA
TTTGAGCAGTATATGCAATGGCAGAGTGCACAGGATGCTGCGTGCTATGC
AGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy