Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR637 IGR639 IGR634 IGR638 IGR635 IGR636 IGR632 IGR633 TP0871 TP0881 TP0878 TP0879 TP0874 TP0875 TP0873 TP0876 flaB3, - TP0870 TP0877 TP0872 TP0871 TP0881 TP0878 TP0879 TP0874 TP0875 TP0873 TP0876 flaB3, - TP0870 TP0877 TP0872 Type: tandem, Name:  - 191 Type: tandem, Name:  - 192 Type: tandem, Name:  - 193 TP0871 TP0878 TP0879 TP0880 TP0881 TP0880 TP0873 TP0876 flaB3, - TP0870 TP0877 TP0872 TP0875 TP0874
* Calculated from Protein Sequence

Gene ID: TP0876

DNA Molecule Name:
1  

Genbank ID:
3323188

Gene Name:


Definition:
conserved hypothetical protein/ possible endopeptidase

Gene Start:
952990

Gene Stop:
953652

Gene Length:
663

Molecular Weight*:
23632

pI*:
9.44

Net Charge*:
8.39

EC:
3.4.-.-  

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed two significant hits to hypothetical proteins
with similarity to endopeptidases. For example residues 1-177 are 27%
similar to glycoprotein endopeptidase homolog of Bacillus subtilis,
(Z99107).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1214
COG name: Inactive homologs of metal-dependent proteases, putative molecular chaperones
Functional Class:  O
The phylogenetic pattern of COG1214 is ------vcebrh--gpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 26-52 represent a significant (95%) hit to block PR00169H,
POTASSIUM CHANNEL SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 37-96 are 35% similar to YEAZ_ECOLI, a hypothetical protein
with similarity to proteases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
75  
102

PDB Hit:
none

Gene Protein Sequence:
MNILAINTVAHALNVAAEGAQGTAVVSIEGAHCCIQQQLVRALDVVVKRA
GFPVQETQIVACPRGPGSFTGLRTGFAVAKALQLGVGARFIAVPTLRLAA
HPFRAFTGRVLSILDAKRGRFFWNCFKSGEPLFEDSHNHAQEIVKKVDTR
VPCLVCGTGTALFKSVMESQDNTVPFMYVETDAHEGAKTLLALVKVLNHS
AATPGERGAPQYTTRTYAKGS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATACTTGCCATCAACACCGTTGCGCATGCCCTCAACGTTGCAGC
TGAAGGAGCACAAGGCACCGCTGTTGTGAGCATCGAAGGTGCGCATTGTT
GCATACAGCAACAGCTCGTGCGTGCGCTTGACGTTGTCGTAAAACGCGCA
GGATTTCCTGTACAGGAAACACAAATCGTTGCCTGTCCTCGGGGGCCTGG
TTCATTTACCGGCTTGCGTACCGGTTTTGCAGTTGCAAAAGCCCTACAGC
TGGGTGTCGGAGCCCGTTTTATTGCCGTGCCTACGCTGCGCCTTGCGGCA
CATCCGTTCCGCGCGTTCACAGGACGGGTGTTGTCCATACTAGATGCAAA
ACGTGGTCGTTTTTTTTGGAACTGCTTTAAGTCAGGAGAGCCGCTCTTTG
AAGACTCTCACAACCACGCACAAGAAATCGTAAAAAAAGTGGACACACGG
GTTCCATGCCTGGTGTGCGGCACGGGAACAGCACTTTTTAAAAGTGTAAT
GGAAAGCCAGGACAACACGGTTCCTTTCATGTACGTAGAAACTGACGCTC
ATGAAGGAGCAAAGACACTCCTTGCTTTGGTAAAAGTGCTCAATCACAGC
GCCGCCACTCCGGGGGAGCGCGGAGCGCCGCAGTACACAACACGAACTTA
CGCAAAAGGAAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy