Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR627 IGR626 IGR622 IGR623 IGR621 IGR628 IGR625 IGR624 fklB,mip, - TP0862 TP0865 TP0864 glmS, - TP0861 TP0859 TP0860 TP0858 nifS, - TP0863 fklB,mip, - TP0862 TP0865 TP0864 glmS, - TP0861 TP0859 TP0860 TP0858 nifS, - TP0863 Type: tandem, Name:  - 300 Type: tandem, Name:  - 189 Type: tandem, Name:  - 190 Type: tandem, Name:  - 274 fklB,mip, - TP0862 TP0865 TP0864 glmS, - TP0861 TP0859 TP0860 TP0858 nifS, - TP0863
* Calculated from Protein Sequence

Gene ID: TP0862

DNA Molecule Name:
1  

Genbank ID:
3323173

Gene Name:
fklB  mip  

Definition:
peptidyl-prolyl isomerase (macrophage infectivity potentiator)

Gene Start:
940212

Gene Stop:
939421

Gene Length:
792

Molecular Weight*:
28401

pI*:
8.57

Net Charge*:
1.92

EC:
5.2.1.8  

Functional Class:
translation; Protein modification  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Ppiases accelerate the folding of proteins. See Shevchenko et al.,Infect Immun 1997 Oct;65(10):4179-89.
Is this protein what they identify as ppiB?

Reaction:
CIS-TRANS ISOMERIZATION OF PROLINE IMIDIC PEPTIDE BONDS IN OLIGOPEPTIDES.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle and C-terminal regions had several
significant hits to peptidylprolyl isomerase proteins and macrophage
infectivity potentiator proteins. For example residues 72-257 are
41% similar to FKBB_ECOLI, peptidyl-prolyl cis-trans isomerase of
E. coli. One iteration of PSI-BLAST moved several macrophage
infectivity potentiator proteins to the top.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0545
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 1
Functional Class:  O
The phylogenetic pattern of COG0545 is ----Y--cE--h-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 179-193, 200-233, and 241-253 represent significant (99%) hits
to blocks BL00453A,B,C, FKBP-type peptidyl-prolyl cis-trans isomerase
proteins.

ProDom Summary:  Protein Domain Search
Residues 176-243 are 57% similar to peptidyl-prolyl cis-trans
isomerase of FKBB_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 35 to 161 (E-value = 2.3e-05) place TP0862 in the FKBP_N family which is described as Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346)
Residues 165 to 254 (E-value = 2.2e-36) place TP0862 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
30
coil-coil  
104  
144

PDB Hit:
gi|1827930|pdb|1BKF| Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Isomerase, Rotamase Mol_id: 1; Molecule: Fk506 Binding Protein; Chain: Null; Synonym: Fkbp; Ec: 5.2.1.8; Engineered: Yes; Mutation: R42k, H87v; Other_...

Gene Protein Sequence:
MILKKEAAGVCSFALLLLAGMSIFSCRKGAEGVSSAGEAADKKALTADQL
DPRKVQEQERQKTPLSKKSVGYAFGVLMGVTLQDSKLDVDLGQVWKGLKK
TVSADKDKQALADAQDVLQRAFEAYRQKEVEKNSQEAKAFLEENAKKPGV
QVTSSGLQYEVVKAADGPKPQGGQRVRTQYKGTLLDGTVFDASRDKPAEF
PVDGMVPGVSEGLKLMPVGSTYRFYVPSSLGYGERGIEGVIPPGALLVFE
IELQEILPDSASKK

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTTTGAAAAAAGAAGCTGCAGGGGTGTGTTCTTTCGCGCTTCTGCT
CCTTGCGGGTATGAGTATTTTTTCCTGTCGGAAGGGTGCTGAGGGGGTGT
CCTCTGCCGGGGAGGCTGCGGATAAGAAGGCGCTGACTGCTGATCAGCTC
GATCCGCGAAAGGTGCAGGAGCAGGAGCGGCAGAAGACGCCGCTTTCAAA
GAAGAGTGTGGGGTATGCCTTTGGGGTTCTCATGGGGGTGACGCTGCAGG
ATTCGAAGTTAGACGTTGACCTGGGTCAGGTGTGGAAGGGTCTAAAGAAG
ACAGTCAGTGCAGACAAGGATAAGCAGGCACTTGCGGATGCGCAGGACGT
GCTACAGCGTGCGTTCGAGGCATATCGGCAAAAAGAGGTAGAGAAGAATT
CGCAGGAGGCAAAGGCCTTTCTTGAAGAGAATGCGAAGAAGCCAGGTGTG
CAGGTAACTTCCTCTGGGTTGCAGTACGAGGTGGTAAAGGCTGCAGATGG
TCCAAAGCCGCAGGGCGGTCAGAGGGTGCGCACTCAGTACAAGGGGACGC
TGCTTGATGGAACGGTGTTTGATGCCTCTCGAGATAAGCCTGCGGAGTTT
CCGGTGGATGGTATGGTGCCTGGGGTATCTGAGGGCTTAAAGCTGATGCC
GGTGGGTTCTACCTATCGGTTTTATGTGCCTTCTTCCTTGGGGTATGGGG
AGCGTGGTATCGAGGGGGTTATCCCTCCAGGTGCGCTCCTAGTTTTTGAG
ATAGAGTTACAGGAAATACTCCCAGATTCAGCTTCGAAAAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy