Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR620 IGR626 IGR622 IGR623 IGR621 IGR625 IGR624 TP0857 fklB,mip, - TP0862 TP0864 glmS, - TP0861 TP0859 TP0860 TP0856 TP0858 nifS, - TP0863 TP0857 fklB,mip, - TP0862 TP0864 glmS, - TP0861 TP0859 TP0860 TP0856 TP0858 nifS, - TP0863 Type: tandem, Name:  - 189 Type: tandem, Name:  - 274 Type: tandem, Name:  - 300 TP0857 fklB,mip, - TP0862 TP0864 glmS, - TP0861 TP0859 TP0860 TP0856 TP0858 nifS, - TP0863
* Calculated from Protein Sequence

Gene ID: TP0861

DNA Molecule Name:
1  

Genbank ID:
3323172

Gene Name:
glmS  

Definition:
glucosamine-fructose-6-phosphate aminotransferase

Gene Start:
939181

Gene Stop:
937277

Gene Length:
1905

Molecular Weight*:
69172

pI*:
7.30

Net Charge*:
4.02

EC:
2.6.1.16  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Nucleotide metabolism; Aminosugars metabolism

Comment:
Reaction:
L-GLUTAMINE + D-FRUCTOSE 6-PHOSPHATE =
L-GLUTAMATE + D-GLUCOSAMINE 6-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glucosamine-fructose-
6-phosphate aminotransferase proteins. For example residues 1-635 are
51% similar to GLMS_HAEIN,glucosamine-fructose-6-phosphate aminotransferase
of Haemophilus influenzae,(U32726).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 24-33, 69-79, 96-112, and 619-634 represent significant (99%)
hits to blocks BL00443A,B,C,E, Glutamine amidotransferases class-II
proteins.

ProDom Summary:  Protein Domain Search
Residues 429-635 are 54% similar to glucosamine-fructose-6-phosphate
aminotransferase of GLMS_HAEIN. Residues 17-181, 182-273, 309-410,
and 429-635 also support this match. Residues 279-539 are 23%
similar to AgaS protein of AGAS_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 134 (E-value = 4.9e-52) place TP0861 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)
Residues 300 to 435 (E-value = 3e-39) place TP0861 in the SIS family which is described as SIS domain (PF01380)
Residues 473 to 621 (E-value = 1.4e-29) place TP0861 in the SIS family which is described as SIS domain (PF01380)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
66
transmembrane  
595  
614

PDB Hit:
gi|1827657|pdb|1GMS|A Escherichia coli

Gene Protein Sequence:
MCGIVGMVAGRDVSGLLLEGLRRLEYRGYDSAGIAVVGSDCALRLLRCEG
RVQSLCALLGQSPLCGTMGIAHTRWATHGKPCAANAHPHCSESVAIVHNG
IVENHRSLREMLVTRGYFFHSQTDSEVLAHLLHWELRYTAHLLLAVKKVL
TQVRGTYGLLCMDAASPGRLIAARSGSPLAVGLGCGENFVTSDPLALAHV
TQRFLYLEEGDIADVHRDSVCVHDAQGNVVARPVVTYQMQLCTQDKGTHR
HHMHQEIWQQPHAIRHTLNAYMSFSSSSRAQVRTFGEDRVLDGTSCKTFE
RLFRRITRVRIIACGTSYHAGLVARYWFEAFAGVGCQVEIASEYRYRTSV
VHAREIVLTISQSGETADTIAALRLAKTQGYLCAIAICNGARSTLVRESD
AVLLTHAGSEIGVASTKSFTTQLVCLLVLTRMIAQAKKILTQEPEDALSA
ALQRLPQDVEHVLECEADVARCARHFVHAQHALFLGRGELYPIAIESALK
LKEISYIHAEAYAAGELKHGPLALVDAQMPVVAIAPASPGVLFEKMASNI
EEVRARGGMLYIFTDVPERFGPVCTPEADAPEGACSQIVTVPSVSPLTAP
IFYAVPLQLLAYHIALLKGTDIDQPRNLAKSVTVE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTGGAATCGTTGGGATGGTGGCGGGGCGTGATGTCTCAGGTCTCTT
GCTTGAGGGGCTGCGTCGTCTTGAATACCGCGGGTATGATTCTGCAGGGA
TCGCTGTCGTTGGCTCGGACTGTGCGCTCCGCCTTTTACGCTGTGAGGGT
CGTGTTCAGTCGCTCTGCGCGCTATTAGGTCAGAGTCCTCTTTGCGGGAC
CATGGGCATTGCGCACACCCGGTGGGCAACGCACGGCAAGCCGTGTGCAG
CGAATGCGCATCCGCATTGTTCTGAATCCGTTGCGATAGTTCACAACGGT
ATTGTTGAAAACCATCGGTCTTTGCGTGAAATGCTAGTGACCCGTGGCTA
TTTTTTTCATTCACAAACTGATAGCGAGGTGCTCGCGCATCTTTTGCACT
GGGAGTTGCGGTACACGGCGCACCTCCTGCTTGCGGTAAAAAAAGTGTTG
ACGCAGGTTCGGGGTACCTACGGGTTACTTTGCATGGACGCTGCATCTCC
TGGGCGGTTGATTGCTGCGCGTTCTGGCAGTCCGTTGGCGGTAGGACTCG
GCTGTGGGGAAAATTTTGTTACGTCAGACCCGCTTGCGCTTGCGCATGTT
ACGCAGCGTTTTTTGTATCTTGAGGAAGGAGACATCGCAGACGTCCACCG
AGATAGCGTGTGCGTCCACGACGCGCAGGGAAACGTTGTGGCGCGTCCTG
TTGTTACGTATCAGATGCAGCTTTGTACGCAGGATAAGGGTACGCACCGT
CACCATATGCATCAAGAAATATGGCAGCAGCCACACGCTATACGGCATAC
GCTGAATGCCTATATGTCGTTTTCTTCGTCTTCTCGCGCACAGGTGCGGA
CGTTCGGGGAGGACCGGGTCTTGGACGGTACCTCGTGTAAGACGTTTGAG
CGGCTGTTTAGACGGATAACACGGGTGCGCATTATCGCGTGTGGTACCTC
GTACCATGCAGGGTTAGTGGCGCGTTACTGGTTTGAGGCATTTGCAGGGG
TGGGATGTCAGGTGGAGATTGCCTCAGAGTACCGCTATCGCACGAGCGTC
GTGCACGCGCGTGAAATAGTACTGACGATTTCTCAGTCGGGAGAAACGGC
TGACACCATTGCCGCACTGCGCCTGGCAAAAACGCAAGGGTATCTCTGTG
CGATTGCCATTTGCAACGGGGCACGTTCCACGTTGGTGCGTGAGTCGGAC
GCAGTGCTGCTCACCCACGCGGGGTCAGAAATAGGGGTTGCTTCAACGAA
GTCTTTTACCACCCAGCTGGTGTGCTTGCTCGTGCTCACCCGCATGATTG
CGCAGGCAAAAAAGATACTCACGCAGGAGCCCGAGGACGCGCTCTCTGCG
GCGCTCCAGCGACTGCCTCAGGATGTGGAGCACGTGCTTGAGTGTGAGGC
AGACGTTGCGCGGTGCGCGCGGCATTTTGTGCATGCGCAGCATGCGCTCT
TTTTGGGGCGTGGGGAATTGTATCCGATTGCAATTGAATCGGCGCTCAAG
CTGAAAGAAATTTCGTACATCCATGCCGAAGCATACGCAGCGGGGGAGCT
AAAGCATGGGCCCCTTGCATTAGTGGACGCGCAGATGCCGGTGGTTGCAA
TCGCGCCGGCGTCACCTGGCGTCCTGTTTGAAAAAATGGCCTCAAACATC
GAGGAAGTTCGCGCGCGCGGCGGGATGCTCTACATCTTTACGGACGTGCC
GGAGCGTTTTGGCCCGGTATGCACGCCCGAGGCGGACGCGCCGGAAGGGG
CGTGCAGTCAGATAGTCACCGTACCTTCGGTATCTCCCCTTACCGCGCCG
ATTTTTTACGCCGTACCGCTGCAGCTGTTGGCATACCACATTGCCCTGCT
CAAGGGGACTGACATTGACCAGCCGCGGAACCTGGCAAAATCGGTGACGG
TCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy