Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR612 IGR616 IGR613 IGR614 IGR618 IGR617 IGR615 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 lgt, - TP0852 TP0853 TP0854 TP0851 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 lgt, - TP0852 TP0853 TP0854 TP0851 Type: tandem, Name:  - 187 Type: tandem, Name:  - 305 infC, - TP0850 lgt, - TP0852 TP0853 TP0854 TP0846 TP0847 rplT, - TP0848 TP0845 TP0847 rpmI, - TP0849 TP0846 TP0851
* Calculated from Protein Sequence

Gene ID: TP0852

DNA Molecule Name:
1  

Genbank ID:
3323164

Gene Name:
lgt  

Definition:
prolipoprotein diacylglyceryl transferase

Gene Start:
923642

Gene Stop:
922647

Gene Length:
996

Molecular Weight*:
38142

pI*:
9.89

Net Charge*:
8.25

EC:
2.4.99.-  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Leskelä S, Wahlström E, Kontinen VP, Sarvas M.
Lipid modification of prelipoproteins is dispensable for growth but essential for efficient protein secretion in Bacillus subtilis: characterization of the Lgt gene.
Mol Microbiol. 1999 Feb;31(4):1075-85.
PMID: 10096076

Bengtsson J, Tjalsma H, Rivolta C, Hederstedt L.
Subunit II of Bacillus subtilis cytochrome c oxidase is a lipoprotein.
J Bacteriol. 1999 Jan;181(2):685-8.
PMID: 9882689

Sankaran K, Gan K, Rash B, Qi HY, Wu HC, Rick PD.
Roles of histidine-103 and tyrosine-235 in the function of the prolipoprotein diacylglyceryl transferase of Escherichia coli.
J Bacteriol. 1997 May;179(9):2944-8.
PMID: 9139912

Qi HY, Sankaran K, Gan K, Wu HC.
Structure-function relationship of bacterial prolipoprotein diacylglyceryl transferase: functionally significant conserved regions.
J Bacteriol. 1995 Dec;177(23):6820-4.
PMID: 7592473

Comment:
This protein transfers the N-acyl diglyceride group on what will
become the N-terminal cysteine of membrane lipoproteins. It is the
first step in lipoproteins biosynthesis.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to prolipoprotein
diacylglyceryl transferase proteins. For example residues 4-312
are 36% similar to prolipoprotein diacylglyceryl transferase of
Borrelia burgdorferi,(AE001142).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0682
COG name: Prolipoprotein diacylglyceryltransferase
Functional Class:? M
The phylogenetic pattern of COG0682 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 217-312 are 42% similar to prolipoprotein diacylglyceryl
transferase of LGT_ECOLI. Residues 22-133 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 10 to 321 (E-value = 3.1e-115) place TP0852 in the LGT family which is described as Prolipoprotein diacylglyceryl transferase (PF01790)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
39
transmembrane  
66  
90
transmembrane  
228  
262
transmembrane  
299  
319

PDB Hit:
none

Gene Protein Sequence:
MLSIVYPSWIRPEIIPSFPYFRWYGFMYVVAFSIAYILFRYQVRRGELDK
WSRVSEPVTQDDIMSFFTWTILGILIGARVFSTMVYEVDLLYMRKPWLIF
WPFSLQTGEWVGLRGMSYHGGLIGALVGGGLWTQSHGRSFLAWADVAAAS
TPLGYTFGRIGNFLNAELYGRITDIPIGMIFPNVPLSDMFPASEPWVREF
AQRVGIHVQEGARLVNLPRHPSQIYEAFFEGIVLWCILWCARRVKTYNGF
LVCLYVVGYGVFRFFIEYFRQPDAHLGYRFSATQSSPIYLFQSWSDVSTG
QILCVLMILAGLGGMFALSAYHKRDSVRKARV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAGTATTGTCTATCCGTCGTGGATTCGTCCGGAAATAATTCCTTC
TTTTCCCTATTTTCGCTGGTACGGCTTCATGTATGTGGTTGCATTCAGTA
TCGCGTACATACTGTTTCGCTACCAGGTGCGGCGCGGTGAGCTTGATAAA
TGGAGTCGGGTGAGCGAGCCTGTCACGCAGGATGACATTATGAGTTTTTT
TACGTGGACGATTCTGGGCATTTTAATAGGGGCGCGTGTTTTTTCCACCA
TGGTGTATGAGGTCGATTTGCTGTATATGCGCAAGCCATGGCTGATTTTT
TGGCCGTTTTCTTTGCAAACGGGTGAGTGGGTTGGATTGCGAGGAATGTC
GTACCACGGTGGGTTAATTGGCGCGCTCGTGGGGGGTGGCTTGTGGACTC
AGTCGCATGGGAGAAGCTTTCTTGCATGGGCCGATGTCGCTGCAGCGTCA
ACTCCACTTGGGTATACTTTTGGAAGAATTGGTAATTTCCTTAATGCTGA
ATTATATGGGCGTATTACTGATATCCCCATCGGCATGATTTTCCCGAATG
TTCCCTTATCTGACATGTTTCCTGCCTCTGAACCTTGGGTGAGGGAGTTT
GCACAGAGGGTGGGGATTCACGTGCAAGAAGGTGCACGGCTCGTGAATTT
GCCTCGTCACCCTAGCCAAATCTATGAAGCTTTTTTTGAAGGAATTGTGC
TGTGGTGTATTTTGTGGTGTGCGCGTCGGGTAAAAACGTATAACGGCTTT
TTGGTGTGTTTGTATGTGGTGGGGTACGGAGTGTTTCGTTTTTTTATTGA
GTATTTTCGTCAGCCTGATGCGCATTTGGGGTACAGGTTTTCCGCCACGC
AATCGTCTCCGATTTACCTTTTCCAGTCATGGAGTGATGTTTCCACCGGG
CAGATTCTGTGTGTTCTAATGATTCTCGCAGGTTTGGGTGGGATGTTCGC
ACTTTCGGCGTATCACAAGCGGGATAGTGTGCGGAAAGCGCGTGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy