Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR612 IGR613 IGR614 IGR611 IGR607 IGR610 IGR609 IGR615 IGR608 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 map, - TP0842 TP0843 htrA, - TP0841 gap, - TP0844 TP0851 TP0840 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 map, - TP0842 TP0843 htrA, - TP0841 gap, - TP0844 TP0851 TP0840 Type: tandem, Name:  - 187 Type: tandem, Name:  - 271 infC, - TP0850 map, - TP0842 TP0843 htrA, - TP0841 TP0846 TP0847 rplT, - TP0848 TP0845 TP0847 rpmI, - TP0849 TP0846 gap, - TP0844 TP0851 TP0840
* Calculated from Protein Sequence

Gene ID: TP0844

DNA Molecule Name:
1  

Genbank ID:
3323159

Gene Name:
gap  

Definition:
glyceraldehyde 3-phosphate dehydrogenase

Gene Start:
916752

Gene Stop:
917801

Gene Length:
1050

Molecular Weight*:
38071

pI*:
8.34

Net Charge*:
4.46

EC:
1.2.1.12  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Energy metabolism; Carbon fixation

Secondary Evidence:
Figge RM, Schubert M, Brinkmann H, Cerff R. Glyceraldehyde-3-phosphate dehydrogenase gene diversity in eubacteria and eukaryotes: evidence for intra- and inter-kingdom gene transfer. Mol Biol Evol. Apr;16(4):429-40. Medline: 99261655.



Comment:
Reaction:
D-GLYCERALDEHYDE 3-PHOSPHATE + ORTHOPHOSPHATE + NAD(+) =
1,3-DIPHOSPHATEGLYCERATE + NADH.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glyceraldehyde
3-phosphate dehydrogenases. For example residues 1-349 are 63%
similar to G3PG_TRYCR,glyceraldehyde 3-phosphate dehydrogenase of
Trypanosoma cruzi,(X52898).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0057
COG name: Glyceraldehyde-3-phosphate dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0057 is amtkYqvCEBrhUJgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 2-13, 94-127, 95-128, 156-190, 157-191, 214-248, 216-270,
202-256, 322-342 represent significant (100%) hits to blocks
BL00071A,B,C,D,E, Glyceraldehyde 3-phosphate dehydrogenase proteins.

ProDom Summary:  Protein Domain Search
Residues 41-343 are 64% similar to glyceraldehyde 3-phosphate
dehydrogenase of G3PG_TRYCR. Residues 3-34 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 162 (E-value = 8e-81) place TP0844 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 163 to 329 (E-value = 2e-104) place TP0844 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

PDB Hit:
gi|1311019|pdb|1GYP|A Leishmania mexicana

Gene Protein Sequence:
MRVAINGFGRIGRLVLQAMAEQKLLGKEFDVAAVVDLSTDARYFAYQLKY
DSVQGKMGSSLSAPAEDILEVGGHRIKCVCGRGLKPSQLPWKDLGIEVVI
EATGIYANESSYGHLEAGAKRVIISAPAKSSDASKPVKTIVMGVNEHEFD
PAEHKVVSNASCTTNCLAPVVHVFLKEGVGIETGLMTTIHSYTATQKTVD
GVSLKDWRGGRAAAVNIIPSTTGAAKAVGEVLPSTRGKLTGMAFRVPTPT
GSVVDLTFRTEKETSVADLNAMLKKASESYLRGVLQYCDEDIVSADVIHN
QYSSIYDSRATLQNNLPNEKRFFKVVSWYDNEWGYSNRVVDLLKFISQKR


Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGTTGCAATCAATGGTTTTGGGCGTATCGGGCGTCTCGTACTCCA
GGCCATGGCGGAGCAGAAGCTGTTGGGGAAAGAGTTCGACGTGGCGGCAG
TTGTAGACCTTTCCACCGATGCGCGCTACTTTGCCTATCAGCTAAAGTAT
GACTCCGTGCAGGGCAAAATGGGTTCTAGTCTCAGTGCTCCTGCCGAGGA
TATCCTCGAGGTGGGCGGGCATCGGATCAAGTGTGTCTGCGGTCGCGGCT
TAAAGCCTTCCCAACTTCCCTGGAAGGATCTTGGTATTGAGGTGGTTATT
GAGGCCACCGGCATTTACGCGAATGAGTCTTCATACGGTCACCTTGAAGC
AGGAGCAAAGCGAGTCATCATCAGTGCTCCGGCTAAGAGCTCGGATGCGT
CTAAGCCGGTGAAGACTATTGTAATGGGGGTGAACGAGCATGAGTTCGAT
CCTGCTGAGCACAAGGTCGTCTCCAACGCGAGCTGCACTACCAACTGTCT
CGCGCCGGTAGTGCACGTCTTTCTCAAAGAGGGAGTCGGTATTGAAACGG
GACTGATGACGACTATCCACTCCTATACCGCAACGCAAAAAACTGTAGAT
GGGGTTTCTTTGAAGGACTGGCGCGGAGGCCGCGCTGCAGCGGTTAACAT
TATCCCTTCCACCACTGGAGCTGCGAAAGCGGTAGGCGAAGTGCTGCCGT
CTACGAGAGGTAAGTTGACGGGGATGGCCTTCCGTGTCCCGACACCAACC
GGTTCCGTGGTGGATCTAACCTTCCGCACGGAAAAAGAGACGAGCGTTGC
GGACCTCAACGCGATGCTCAAGAAGGCGTCGGAGTCCTATCTGCGGGGTG
TCCTGCAGTATTGCGACGAGGATATTGTATCCGCGGACGTCATCCACAAC
CAGTACTCCTCCATCTACGACAGCAGGGCGACGCTGCAGAACAACCTCCC
GAACGAGAAGCGCTTCTTCAAGGTAGTGTCCTGGTATGACAACGAGTGGG
GTTACTCAAACCGTGTGGTGGATTTGCTTAAGTTCATCTCGCAGAAGCGG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy