Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR612 IGR613 IGR614 IGR611 IGR607 IGR610 IGR606 IGR609 IGR615 IGR608 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 map, - TP0842 TP0843 TP0839 htrA, - TP0841 gap, - TP0844 TP0840 rpmI, - TP0849 rplT, - TP0848 infC, - TP0850 TP0845 map, - TP0842 TP0843 TP0839 htrA, - TP0841 gap, - TP0844 TP0840 Type: tandem, Name:  - 271 infC, - TP0850 map, - TP0842 TP0843 TP0839 htrA, - TP0841 TP0846 TP0847 rplT, - TP0848 TP0845 TP0847 rpmI, - TP0849 TP0846 gap, - TP0844 TP0840
* Calculated from Protein Sequence

Gene ID: TP0842

DNA Molecule Name:
1  

Genbank ID:
3323157

Gene Name:
map  

Definition:
methionine aminopeptidase

Gene Start:
915711

Gene Stop:
914947

Gene Length:
765

Molecular Weight*:
27302

pI*:
5.87

Net Charge*:
-5.49

EC:
3.4.11.18  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Chiu CH, Lee CZ, Lin KS, Tam MF, Lin LY.
Amino acid residues involved in the functional integrity of Escherichia coli methionine aminopeptidase.
J Bacteriol. 1999 Aug;181(15):4686-9.
PMID: 10419973

Tsunasawa S, Izu Y, Miyagi M, Kato I.
Methionine aminopeptidase from the hyperthermophilic Archaeon Pyrococcus furiosus: molecular cloning and overexpression in Escherichia coli of the gene, and characteristics of the enzyme.
J Biochem (Tokyo). 1997 Oct;122(4):843-50.
PMID: 9399590

Chang SY, McGary EC, Chang S.
Methionine aminopeptidase gene of Escherichia coli is essential for cell growth.
J Bacteriol. 1989 Jul;171(7):4071-2.
PMID: 2544569

Comment:
This protein removes the amino-terminal methionine from nascent proteins.

Reaction:
L-METHIONYLPEPTIDE + H(2)O = L-METHIONINE + PEPTIDE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to methionine
aminopeptidases. For example residues 1-246 are 40% similar to
AMPM_BACSU, methionine aminopeptidase of Bacillus subtilis,(Z99104).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0024
COG name: Methionine aminopeptidase
Functional Class:? J
The phylogenetic pattern of COG0024 is amtkYqvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 2-41, 58-79, 84-112, 137-182, 32-77, 192-244, and 200-252
represent significant (100%) hits to blocks BL00680A,B,C,D,E,
Methionine aminopeptidase subfamily 1 proteins. Residues 163-175 and
192-206 represent significant (99%) hits to blocks BL00491B,C,
Aminopeptidase P and proline dipeptidase proteins.

ProDom Summary:  Protein Domain Search
Residues 13-196 are 40% similar to methionine aminopeptidase of
AMPM_BACSU. Residues 203-246 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 162 to 236 (E-value = 1.6e-19) place TP0842 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
98  
207

PDB Hit:
gi|494313|pdb|1MAT| Methionine Aminopeptidase (E.C.3.4.11.18)

Gene Protein Sequence:
MIRIKTPEQIDGIRASCKALARLFDVLIPLVKPGVQTQELDAFCQRFIRS
VGGVPAWFSEGFPAAACISINEEVIHGLPSARVIQDGDLVSLDVGINLNG
YISDACRTVPVGGVAHERLELLRVTTECLRAGIKACRAGARVRAVSRAVY
AVAARHRFGVVYEYCGHGVGLAVHEEPNIPNVPGLEGPNPRFLPGMVVAI
EPMLTLGTDEVRTSADGWTVVTADGSCACHVEHTVAVFADHTEVLTEPTE
VERTG

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCCGCATTAAAACACCAGAACAAATCGACGGTATCCGTGCCTCTTG
CAAGGCATTGGCGCGCCTTTTCGACGTTCTTATTCCGCTTGTCAAACCGG
GCGTTCAAACCCAGGAGCTTGATGCGTTTTGCCAACGCTTCATCCGCTCA
GTCGGTGGTGTTCCTGCCTGGTTCTCGGAAGGTTTTCCTGCCGCTGCTTG
CATTTCAATCAACGAAGAGGTCATCCATGGTTTACCTTCAGCGCGTGTGA
TTCAGGACGGGGATCTTGTTTCCCTTGATGTTGGTATCAACCTCAATGGA
TACATTTCTGACGCGTGTCGTACTGTTCCTGTCGGTGGAGTTGCACACGA
GCGACTAGAACTTTTGCGTGTAACCACTGAGTGCCTCCGTGCGGGCATTA
AAGCGTGCCGTGCCGGAGCGCGCGTGCGCGCTGTTTCTCGCGCTGTATAC
GCTGTTGCAGCACGGCACCGCTTTGGCGTGGTGTACGAATATTGCGGACA
TGGCGTGGGGCTTGCCGTGCATGAGGAGCCGAACATCCCCAATGTGCCTG
GCTTGGAAGGGCCTAATCCACGTTTTTTGCCCGGTATGGTAGTCGCGATA
GAACCCATGTTGACGCTTGGCACAGACGAGGTGCGCACCAGTGCAGATGG
CTGGACGGTGGTAACGGCAGACGGATCGTGTGCCTGCCATGTGGAGCACA
CTGTGGCAGTTTTTGCAGACCACACGGAGGTTTTAACAGAACCTACGGAA
GTAGAGCGTACCGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy