Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR612 IGR611 IGR607 IGR605 IGR610 IGR606 IGR609 IGR608 TP0847 TP0845 map, - TP0842 TP0843 TP0839 htrA, - TP0841 TP0838 gap, - TP0844 TP0840 TP0847 TP0845 map, - TP0842 TP0843 TP0839 htrA, - TP0841 TP0838 gap, - TP0844 TP0840 Type: tandem, Name:  - 271 map, - TP0842 TP0843 TP0839 htrA, - TP0841 TP0838 TP0846 TP0845 TP0847 TP0846 gap, - TP0844 TP0840
* Calculated from Protein Sequence

Gene ID: TP0841

DNA Molecule Name:
1  

Genbank ID:
3323153

Gene Name:
htrA  

Definition:
periplasmic serine protease DO

Gene Start:
914632

Gene Stop:
913178

Gene Length:
1455

Molecular Weight*:
51667

pI*:
10.03

Net Charge*:
7.94

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Noone D, Howell A, Collery R, Devine KM.
YkdA and YvtA, HtrA-like serine proteases in Bacillus subtilis, engage in negative autoregulation and reciprocal cross-regulation of ykdA and yvtA gene expression.
J Bacteriol. 2001 Jan;183(2):654-63.
PMID: 11133960

Noone D, Howell A, Devine KM.
Expression of ykdA, encoding a Bacillus subtilis homologue of HtrA, is heat shock inducible and negatively autoregulated.
J Bacteriol. 2000 Mar;182(6):1592-9.
PMID: 10692364

Comment:
This protein is a serine protease that is required at high temperature.
It is involved in the degradation of damaged proteins. It can degrade
IciA, Ada, casein and globin.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to periplasmic serine
protease DO proteins. For example residues 103-460 are 39% similar to
periplasmic serine protease DO of Borrelia burgdorferi,(AE001123).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0265
COG name: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
Functional Class:? O
The phylogenetic pattern of COG0265 is --t-yqvCEBRHuj--oLinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 122-134, 143-163, 155-175, 185-209, 220-237, 3-20, 243-260,
242-259, 435-447, 329-341, and 182-194 represent significant (100%)
hits to blocks PR00834A,B,C,D,E,F, HTRA/DEGQ PROTEASE FAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 123-292 are 51% similar to periplasmic serine protease DO of
HTRA_ECOLI. Residues 414-460 also support this match. Residues
184-380 are 24% similar to YNM3_YEAST, a hypothetical protein.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0773 and TP0546 both
of which are also periplasmic serine protease DO. Residues 108-386
are 34% similar to TP0773 and residues 102-247 are 31% similar to
TP0546.

Pfam Summary:  Pfam Search
Residues 91 to 276 (E-value = 1.5e-13) place TP0841 in the Trypsin family which is described as Trypsin (PF00089)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
300
non-globular  
403  
485

PDB Hit:
none

Gene Protein Sequence:
MPSADTIARRVAGDSGNAGGRTLLPVGVSRESVQLLERLQNANRQVTAEV
LPSVVTLDVVETRKVRVRDPFGGFPWFFFRGPEGPGAGPGGGSGNKGEAE
EREYKTEGLGSGVIVKKTGKTHYVLTNYHVAGKANEIEIKLHDGRIVKGK
LVGGDQRKDIALVSFEDADPNIRVAVLGDSDAVRVGDIVFAVGSPLGYTS
TVTQGIISALGRFGGPGNNINDFIQTDAAINQGNSGGPMVNIYGEVIGIN
AWIASSSGGSQGIGFSIPINNVKSDIESFIQYGQVKYGWLGVQLVATDAD
TVASLGIAKGTKGVLAAEIFLGSPAHKGGLKPGDYCVKLNGKEVKDVNQF
VRDVGALRIGQTAVFDLIRGGVPMTLSVRITERDEKIVNDYSKLWPGFIP
LPLTEAVRKRLDLKASVRGVLVSNAQSKSPAALMGLKSADIVVAVNDQRV
SSVREFYAVLARQTREVWFDVLRDGQTLSTVRFRF

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCCTCTGCAGACACGATAGCTCGGCGCGTTGCCGGAGACAGTGGGAA
CGCTGGGGGGCGGACATTACTTCCTGTGGGGGTTTCGCGTGAATCGGTGC
AGCTGTTAGAACGGCTGCAAAACGCGAACCGTCAGGTAACTGCCGAAGTG
CTGCCTTCAGTAGTGACGCTGGATGTGGTGGAGACCAGAAAGGTTCGGGT
ACGTGATCCGTTTGGCGGTTTTCCGTGGTTTTTCTTTCGTGGTCCTGAAG
GTCCGGGTGCGGGGCCTGGCGGTGGTTCTGGAAACAAAGGGGAAGCTGAG
GAACGGGAGTACAAAACGGAGGGACTTGGTTCTGGAGTCATTGTAAAGAA
GACAGGGAAGACGCATTACGTGCTTACCAACTATCACGTGGCGGGTAAGG
CTAATGAGATAGAGATTAAACTGCACGATGGCAGAATCGTAAAAGGTAAA
CTTGTCGGTGGTGACCAGCGCAAGGACATCGCGCTGGTCTCCTTTGAGGA
CGCAGACCCAAATATCCGTGTTGCCGTCCTTGGTGACTCGGATGCAGTAC
GGGTAGGAGACATTGTGTTCGCAGTTGGCTCTCCTCTTGGGTACACTTCC
ACTGTAACGCAGGGGATTATCAGTGCGCTGGGTCGCTTTGGGGGACCGGG
CAACAATATTAATGATTTTATTCAAACAGATGCGGCCATAAACCAGGGCA
ATTCCGGGGGACCAATGGTCAATATTTATGGCGAAGTGATTGGGATTAAC
GCGTGGATTGCCTCCTCAAGTGGGGGATCGCAAGGGATTGGTTTTTCAAT
TCCTATCAATAATGTGAAGTCGGATATCGAATCATTTATCCAGTACGGGC
AGGTGAAGTACGGGTGGTTAGGCGTGCAGCTGGTGGCAACGGATGCGGAC
ACCGTAGCATCGCTTGGTATTGCAAAGGGTACAAAAGGGGTGCTTGCGGC
GGAAATTTTCTTAGGTTCTCCTGCGCACAAGGGGGGACTGAAACCGGGCG
ATTACTGTGTAAAACTGAACGGAAAAGAAGTAAAGGATGTAAATCAGTTT
GTGCGGGATGTCGGCGCGCTGCGCATTGGGCAAACAGCAGTATTCGATTT
AATTCGCGGTGGTGTGCCGATGACGCTTTCGGTGCGCATTACGGAGCGTG
ATGAAAAAATAGTAAATGACTACTCAAAGCTTTGGCCTGGGTTCATCCCA
CTGCCGCTTACGGAGGCCGTGCGTAAACGTTTGGATTTGAAAGCGTCGGT
GCGTGGTGTGCTAGTTAGCAACGCGCAGAGCAAAAGCCCTGCGGCGCTGA
TGGGATTGAAGTCGGCGGACATAGTAGTGGCGGTCAATGATCAAAGAGTC
TCGAGCGTGCGTGAGTTTTACGCGGTGCTTGCACGTCAGACGAGGGAGGT
GTGGTTTGACGTGTTGCGCGATGGGCAAACGCTTTCTACCGTGCGATTTC
GGTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy