Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR604 IGR605 IGR601 IGR606 IGR602 IGR603 TP0836 TP0839 tyrS, - TP0834 TP0838 TP0835 thrS, - TP0837 TP0840 TP0836 TP0839 tyrS, - TP0834 TP0838 TP0835 thrS, - TP0837 TP0840 TP0836 TP0839 tyrS, - TP0834 TP0838 TP0835 thrS, - TP0837 TP0840
* Calculated from Protein Sequence

Gene ID: TP0837

DNA Molecule Name:
1  

Genbank ID:
3323150

Gene Name:
thrS  

Definition:
threonyl-tRNA synthetase

Gene Start:
906186

Gene Stop:
907961

Gene Length:
1776

Molecular Weight*:
67390

pI*:
6.89

Net Charge*:
-1.21

EC:
6.1.1.3  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Putzer H, Condon C, Brechemier-Baey D, Brito R, Grunberg-Manago M.
Transfer RNA-mediated antitermination in vitro.
Nucleic Acids Res. 2002 Jul;30(14):3026-33.
PMID: 12136084

Nogueira T, de Smit M, Graffe M, Springer M.
The relationship between translational control and mRNA degradation for the Escherichia coli threonyl-tRNA synthetase gene.
J Mol Biol. 2001 Jul;310(4):709-22.
PMID: 11453682

Luo D, Condon C, Grunberg-Manago M, Putzer H.
In vitro and in vivo secondary structure probing of the thrS leader in Bacillus subtilis.
Nucleic Acids Res. 1998 Dec;26(23):5379-87.
PMID: 9826762

Condon C, Putzer H, Grunberg-Manago M.
Processing of the leader mRNA plays a major role in the induction of thrS expression following threonine starvation in Bacillus subtilis.
Proc Natl Acad Sci U S A. 1996 Jul;93(14):6992-7.
PMID: 8692931

Comment:
ThrS is also a translational repressor protein, it controls the
translation of its own gene by binding to its mRNA.

Reaction:
ATP + L-THREONINE + TRNA(THR) = AMP + PYROPHOSPHATE + L-THREONYL-TRNA(THR).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to threonyl-tRNA
synthetase. For example residues 5-590 are 46% similar to SYT_HAEIN,
threonyl-tRNA synthetase of Haemophilus influenzae,(U32816).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0441
COG name: Threonyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0441 is amtkYqVceBrhujgpoLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 368-501 are 64% similar to threonyl-tRNA synthetase of
SYT_PSESY. Residues 19-142, 147-198, 208-271, 275-299, 300-348,
368-501, and 516-551 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0160, prolyl-tRNA synthetase
and TP1017, alanyl-tRNA synthetase. Residues 218-368 are 27% similar
to TP0160 and residues 24-135 are 26% similar to TP1017.

Pfam Summary:  Pfam Search
Residues 212 to 365 (E-value = 4.4e-55) place TP0837 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 495 to 584 (E-value = 8.9e-26) place TP0837 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
32

PDB Hit:
none

Gene Protein Sequence:
MGLCVEENITMLQKRSDTLDRLRHSLAHVMAEAVQALFPGTKLAVGPPID
YGFYYDFSPPRPLCDADLAPIEEKMRAILRAGCPFVKEVVSRPDALARFK
DEPFKQELIERISADDTLSLYHSGAFTDLCRGPHVQSMRDINPHAFKLTS
IAGAYWRGNERGPQLTRIYGTAWESEEDLHTYLRMQDEAKRRDHRKLGPA
LGLFHLDEENPGQVFWHPEGWTLYVAIQQYLRRVMHEDGYAEVHTPFVMP
QSLWERSGHWDKYRANMYLTEGEKRSFALKPMNCPGHVEIFKQKTRSYRD
LPLRLSEFGSCTRNEPSGSLHGVMRVRGFVQDDAHIFCTEAQIASEVTRF
CRLLARVYADFGFAQEQIRVKFSTRPEQRIGDDATWDRAERALAEACEAA
GLSYEHAPGEGAFYGPKLEFALIDTLEREWQCGTIQVDYQLPSCERLNAE
YVGEDNQRHMPVILHRTVIGSLERFIGILIEHYGGAFPPWLAPVQAVVIP
VAPAFLEYAQHVARELCARSLRVQADVSAERMNAKIRTAQTQKVPYLLIV
GERELRAQQVAVRPRTGPQHSMGLSAFSTFLLAKLETRALHA

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGCCTCTGTGTAGAAGAGAATATCACCATGCTGCAAAAACGCTCAGA
TACCCTCGACCGTCTGCGTCACAGTCTGGCGCACGTTATGGCAGAGGCCG
TTCAAGCTCTCTTCCCCGGCACCAAGCTCGCGGTGGGGCCGCCTATCGAT
TACGGGTTTTACTATGACTTCTCACCTCCCCGTCCCCTGTGCGATGCAGA
CCTAGCCCCCATTGAAGAGAAAATGCGCGCCATCTTGCGTGCGGGGTGTC
CCTTTGTCAAAGAGGTGGTTTCGCGTCCTGACGCGCTTGCTCGTTTTAAA
GACGAGCCATTCAAGCAAGAGCTCATCGAACGCATCAGCGCAGACGACAC
GCTCAGTCTCTACCACTCCGGCGCGTTCACTGACCTGTGCCGGGGTCCTC
ACGTGCAGTCTATGCGAGACATTAATCCGCACGCCTTTAAACTCACGAGC
ATCGCTGGGGCCTATTGGCGCGGTAATGAGCGCGGCCCCCAGCTGACGCG
CATCTACGGCACTGCCTGGGAATCTGAAGAAGATTTGCACACATACCTTC
GCATGCAGGATGAAGCAAAACGCCGAGATCACCGTAAGCTCGGTCCTGCA
CTCGGTCTCTTTCACTTGGACGAAGAAAATCCTGGCCAGGTCTTTTGGCA
CCCTGAGGGGTGGACCCTCTACGTGGCCATCCAGCAGTACTTGCGCCGCG
TCATGCACGAAGACGGGTACGCAGAGGTGCATACTCCCTTTGTCATGCCC
CAAAGCCTTTGGGAACGCTCGGGGCACTGGGACAAATACCGCGCCAACAT
GTACCTGACCGAAGGCGAGAAGCGTTCTTTTGCGCTCAAGCCCATGAATT
GTCCCGGACATGTCGAAATCTTCAAGCAAAAAACACGCAGTTACCGTGAT
CTCCCGCTCCGTCTTTCGGAGTTTGGCTCGTGCACCCGCAATGAACCGTC
AGGCTCCCTGCATGGAGTTATGCGCGTACGTGGCTTTGTACAAGACGATG
CCCATATCTTTTGTACTGAGGCGCAAATCGCATCGGAGGTCACCCGTTTC
TGTCGCCTCCTTGCGCGGGTATATGCTGACTTTGGCTTTGCACAGGAGCA
GATCCGCGTCAAGTTTTCTACGCGCCCAGAGCAGCGCATCGGAGACGACG
CCACCTGGGACCGGGCCGAACGCGCATTGGCAGAAGCATGTGAAGCAGCA
GGCCTTTCGTACGAGCACGCACCGGGAGAAGGAGCGTTCTATGGACCAAA
GTTGGAGTTTGCACTTATAGATACACTCGAACGCGAGTGGCAGTGCGGCA
CCATTCAGGTAGACTATCAGTTGCCCTCGTGCGAGCGCTTGAACGCAGAG
TATGTGGGGGAGGACAACCAACGGCACATGCCAGTGATACTCCACCGCAC
GGTGATTGGGTCTCTAGAACGGTTCATCGGTATTCTCATTGAACACTACG
GGGGTGCATTCCCCCCATGGCTCGCACCGGTGCAGGCAGTGGTGATTCCG
GTTGCCCCTGCCTTCCTCGAATATGCGCAGCACGTTGCACGGGAGCTGTG
CGCCCGTTCGCTCCGCGTGCAGGCAGACGTGAGCGCAGAGCGCATGAACG
CAAAGATCCGCACTGCCCAAACGCAGAAAGTGCCCTATCTGCTCATAGTT
GGCGAGCGGGAGCTGCGCGCGCAGCAGGTAGCGGTGCGTCCGCGCACAGG
GCCCCAGCACTCAATGGGGCTCTCAGCCTTTTCCACCTTTTTGCTCGCGA
AGCTAGAGACGCGCGCGCTGCACGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy