Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR597 IGR598 IGR600 IGR599 IGR601 IGR602 IGR603 TP0832 TP0836 tyrS, - TP0834 argS, - TP0831 TP0835 TP0833 hisT, - TP0830 TP0829 thrS, - TP0837 TP0832 TP0836 tyrS, - TP0834 argS, - TP0831 TP0835 TP0833 hisT, - TP0830 TP0829 thrS, - TP0837 TP0832 TP0836 tyrS, - TP0834 argS, - TP0831 TP0835 TP0833 TP0829 thrS, - TP0837 hisT, - TP0830
* Calculated from Protein Sequence

Gene ID: TP0834

DNA Molecule Name:
1  

Genbank ID:
3323143

Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthetase

Gene Start:
902182

Gene Stop:
900935

Gene Length:
1248

Molecular Weight*:
45782

pI*:
7.89

Net Charge*:
4.28

EC:
6.1.1.1  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Hamano-Takaku F, Iwama T, Saito-Yano S, Takaku K, Monden Y, Kitabatake M, Soll D, Nishimura S.
A mutant Escherichia coli tyrosyl-tRNA synthetase utilizes the unnatural amino acid azatyrosine more efficiently than tyrosine.
J Biol Chem. 2000 Dec;275(51):40324-8.
PMID: 11006270

Gonzalez-y-Merchand JA, Colston MJ, Cox RA.
Effects of growth conditions on expression of mycobacterial murA and tyrS genes and contributions of their transcripts to precursor rRNA synthesis.
J Bacteriol. 1999 Aug;181(15):4617-27.
PMID: 10419962

Rollins SM, Grundy FJ, Henkin TM.
Analysis of cis-acting sequence and structural elements required for antitermination of the Bacillus subtilis tyrS gene.
Mol Microbiol. 1997 Jul;25(2):411-21.
PMID: 9282752

Grundy FJ, Rollins SM, Henkin TM.
Interaction between the acceptor end of tRNA and the T box stimulates antitermination in the Bacillus subtilis tyrS gene: a new role for the discriminator base.
J Bacteriol. 1994 Aug;176(15):4518-26.
PMID: 8045882

Comment:
Reaction:
ATP + L-TYROSINE + TRNA(TYR) = AMP + PYROPHOSPHATE + L-TYROSYL-TRNA(TYR).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to tyrosyl-tRNA synthetases.
For example residues 8-411 are 48% similar to tyrosyl-tRNA synthetase
of Borrelia burgdorferi,(AE001142).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0162
COG name: Tyrosyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0162 is amtkYqvCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 174-235 are 61% similar to tyrosyl-tRNA synthetase of
SYY_ECOLI. Residues 44-116, 128-164, and 236-265 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 34 to 324 (E-value = 1.9e-121) place TP0834 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
294  
416

PDB Hit:
gi|230779|pdb|2TS1| Tyrosyl-Transfer RNA Synthetase (E.C.6.1.1.1)

Gene Protein Sequence:
MRGIIGSMNPALARLQARGFIRQCTDLSALSARMDAGPLTFYVGVDPTGS
SLHVGHMLPMFALKHLCDAGHRGCVLIGGGTARIGDPSGKTSMRKMLDYA
TLDAYAGAIVAQLDHFLSFDHRHVFYVNNRDWLAHLNYIDFLREVGAHFS
VNKMLTYEAYKKRLETGLSFLEFNYQLLQSYDFLTLSDRYAVELQIGGDD
QWGNIVAGADLVRRVRGKTVHGLTFPLITRADGQKMGKTEQGALFLDPAL
VSPYDFFQYWRNTPDEDVRRFLLLFTFLSVRDVEAILTQGINCAKELLAY
EVTRLMHGTAVAQVALQGARAAFGGCGDKCALPTFELTQCTLQVGIKVTD
LFVQVGLCTTKSDARRLIAQGGAFVGLQRVADIGAVIDQSALDLDGTVIV
RAGKKRVVRIVTDVLE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCGGTATAATCGGCTCCATGAATCCTGCGCTTGCGCGTCTTCAGGC
GCGTGGTTTTATTAGACAATGTACTGATCTTTCGGCGCTTTCGGCGCGTA
TGGATGCAGGCCCACTCACCTTTTATGTCGGTGTAGATCCAACTGGCAGT
AGTTTGCACGTTGGGCACATGCTCCCTATGTTTGCGCTAAAGCATTTGTG
TGATGCGGGGCACCGCGGTTGCGTGCTCATCGGTGGAGGTACCGCGCGTA
TTGGGGATCCCTCCGGCAAAACCAGTATGCGCAAGATGCTCGATTATGCA
ACGCTCGATGCGTACGCGGGAGCGATAGTTGCGCAGCTGGATCATTTTCT
TTCCTTCGATCACAGGCATGTGTTCTATGTGAATAATCGTGATTGGTTGG
CACATTTGAATTACATTGATTTCTTGCGAGAGGTTGGGGCGCATTTTTCT
GTAAACAAAATGCTTACCTATGAGGCGTACAAGAAACGCCTGGAGACAGG
ACTTTCCTTTCTTGAATTTAATTATCAGCTATTGCAGAGCTATGATTTTT
TAACGCTCAGTGATCGCTACGCGGTAGAGTTACAAATTGGCGGCGATGAT
CAATGGGGCAACATTGTTGCCGGGGCGGATTTGGTTCGAAGAGTGCGCGG
AAAAACCGTGCATGGGTTGACCTTTCCGCTCATTACCCGGGCGGATGGGC
AAAAAATGGGCAAGACCGAGCAAGGTGCGCTCTTCTTAGACCCGGCTTTG
GTGTCTCCCTATGACTTTTTCCAATACTGGCGAAATACTCCGGATGAAGA
TGTGCGGCGTTTCTTGCTCCTGTTTACCTTTTTGTCTGTGCGCGATGTCG
AGGCGATATTGACTCAGGGAATTAATTGTGCAAAGGAGCTGTTGGCATAC
GAGGTAACGCGCCTCATGCACGGAACGGCTGTCGCGCAGGTGGCGTTGCA
GGGAGCGCGCGCGGCATTCGGCGGGTGTGGCGATAAGTGTGCATTGCCGA
CGTTCGAGCTGACACAGTGCACGTTGCAAGTTGGGATCAAAGTGACTGAT
TTGTTTGTACAGGTTGGATTGTGTACTACGAAGAGTGATGCACGGCGCTT
GATTGCACAAGGAGGAGCTTTTGTCGGGCTCCAGCGCGTGGCAGATATCG
GTGCGGTAATTGACCAGTCAGCGTTGGATTTGGACGGGACGGTAATAGTT
CGCGCGGGGAAAAAACGCGTGGTGCGCATCGTCACTGACGTGCTTGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy