Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR597 IGR598 IGR600 IGR599 IGR601 TP0832 tyrS, - TP0834 argS, - TP0831 TP0835 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 TP0832 tyrS, - TP0834 argS, - TP0831 TP0835 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 Type: tandem, Name:  - 186 TP0832 tyrS, - TP0834 argS, - TP0831 TP0835 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0826 TP0826 TP0827 dxs, - TP0824 TP0825
* Calculated from Protein Sequence

Gene ID: TP0831

DNA Molecule Name:
1  

Genbank ID:
3323142

Gene Name:
argS  

Definition:
arginyl-tRNA synthetase

Gene Start:
899248

Gene Stop:
897482

Gene Length:
1767

Molecular Weight*:
67123

pI*:
6.95

Net Charge*:
-0.56

EC:
6.1.1.19  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Amino acid metabolism; Arginine and proline metabolism
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Wu JF, Xia X, Wang ED, Wang YL.
Study on the Overexpression of the Gene Encoding Arginyl-tRNA Synthetase under Induction.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai). 1998;30(3):236-240.
PMID: 12174253

Liu W, Wang ED, Wang YL.
A Novel System for Hyper Expression and Rapid Purification of Arginyl-tRNA Synthetase from Escherichia coli.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai). 1999;31(5):494-498.
PMID: 12114958

Jovanovic M, Lilic M, Janjusevic R, Jovanovic G, Savic DJ, Milija J.
tRNA synthetase mutants of Escherichia coli K-12 are resistant to the gyrase inhibitor novobiocin.
J Bacteriol. 1999 May;181(9):2979-83.
PMID: 10217798

Comment:
Reaction:
ATP + L-ARGININE + TRNA(ARG) = AMP + PYROPHOSPHATE + L-ARGINYL-TRNA(ARG).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to arginyl-tRNA synthetase.
For exampl residues 27-589 are 41% similar to arginyl-tRNA synthetase
of Borrelia burgdorferi,(AE001161).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0018
COG name: Arginyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0018 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 132-142 represent a significant (96%) hit to block BL00178A,
Aminoacyl-transfer RNA synthetases class-I proteins.

ProDom Summary:  Protein Domain Search
Residues 127-581 are 31% similar to arginyl-tRNA synthetase of
SYR_METJA.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 6 to 94 (E-value = 4.7e-18) place TP0831 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 103 to 453 (E-value = 5.8e-39) place TP0831 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 467 to 589 (E-value = 9e-49) place TP0831 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

PDB Hit:
none

Gene Protein Sequence:
MQDLCEMWRHAVARVLSQLQGPAVEPVEGAQLVMEEPPEPGMGDIAFPLF
LFAKRVRRSPAQLAQQLCTLLEEDTSMCAYGTPQARGPYLNVFLNKECVA
AHTLDAIFAQGERYGHTQYLQGKRIMVEFSSPNTNKPLHVGHLRNNAIGE
SLSRIIAFCGADVFKVNIINDRGVHICKSMCAYQKFAHGKTPAHTGIKSD
RFVGDWYVQFNRYAQQYPEEAEHDVRDLLQRWESADPHVRALWRTMNEWA
LRGIKQTYERTGISFDKLYFESETYTKGREEVRRGLACGVFYQMEDNSIW
VDLSSLGLDKKALLRSDGTTMYITQDIGTAIFRAQDWPFDQLLYVVGNEQ
NYHFKVLFFVLRLLGYPWAQQLHHVSYGMVNLPHGRMKSREGTVVDADDI
LDRLHSAAEEEIAKKGRENALKHAQCIAENVAIAALHYFLLQVSPQKDMV
FHPEESLSFNGNTGPYLQYMGARISSLLKKVQEDVEQKGPREVRCDPALL
THEAEWELVKALARFPACVTRAAQGHDPSVITGYLYTLSKSFSRFYHDCP
ILCEARPDYACARLELVRAVRIVLRTAMRLVLIPFLEEM

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAGGATCTGTGTGAGATGTGGCGGCACGCCGTCGCCCGGGTGCTTTC
TCAACTGCAGGGGCCTGCCGTTGAGCCGGTCGAAGGTGCGCAGTTAGTTA
TGGAAGAGCCGCCGGAGCCGGGTATGGGGGACATAGCTTTTCCTCTATTC
CTTTTTGCAAAGCGTGTGCGCAGGAGTCCTGCACAGCTTGCACAGCAGTT
GTGCACACTGCTTGAAGAAGACACGTCCATGTGTGCGTATGGCACGCCGC
AGGCGCGAGGACCCTATCTTAATGTCTTTTTAAATAAGGAGTGTGTAGCT
GCGCATACGCTTGATGCTATCTTTGCGCAGGGGGAGCGCTATGGCCACAC
GCAGTACTTACAGGGCAAACGTATCATGGTTGAGTTCTCTAGTCCCAATA
CTAACAAGCCGTTGCATGTAGGTCATCTGCGCAATAACGCGATTGGGGAA
AGCCTTTCGCGTATTATTGCGTTCTGTGGTGCGGATGTGTTCAAGGTAAA
TATCATCAATGATCGCGGAGTACATATCTGTAAATCTATGTGCGCGTATC
AAAAATTCGCCCATGGAAAAACACCTGCGCATACCGGCATCAAGTCCGAT
CGCTTTGTGGGAGATTGGTACGTGCAGTTTAACCGTTACGCACAGCAGTA
CCCGGAAGAAGCAGAGCACGATGTGCGTGACCTGTTACAGCGCTGGGAAA
GTGCAGATCCGCACGTGCGTGCGCTGTGGAGAACAATGAACGAATGGGCG
TTGCGCGGTATCAAACAAACATATGAGCGAACGGGCATATCTTTTGATAA
ACTTTATTTTGAAAGCGAAACTTATACCAAGGGACGTGAAGAGGTTAGAC
GTGGTTTGGCCTGCGGCGTTTTTTATCAGATGGAGGACAACTCTATTTGG
GTGGATTTGTCTTCTCTAGGCTTAGACAAAAAGGCGTTGCTTCGCTCTGA
CGGCACCACTATGTACATTACGCAGGATATTGGCACGGCGATTTTTCGCG
CACAGGACTGGCCCTTTGATCAATTGCTGTATGTTGTGGGAAACGAGCAG
AACTACCACTTTAAGGTATTGTTCTTTGTGCTTAGGTTGCTCGGTTATCC
GTGGGCGCAGCAGTTGCATCACGTCTCTTATGGCATGGTCAACTTGCCCC
ATGGGCGTATGAAGAGTCGAGAGGGGACGGTAGTAGATGCAGACGATATC
TTGGATCGTCTGCACAGTGCGGCAGAAGAGGAAATTGCAAAAAAGGGACG
GGAAAATGCACTGAAACACGCACAGTGTATTGCAGAGAATGTTGCCATCG
CCGCGCTTCATTATTTTTTATTGCAAGTCAGTCCTCAAAAGGATATGGTG
TTTCACCCCGAAGAGTCTTTGTCTTTTAACGGAAACACTGGTCCCTATTT
ACAGTATATGGGTGCTCGCATCTCTTCTCTTTTAAAGAAGGTTCAGGAAG
ATGTGGAGCAAAAGGGACCTCGTGAAGTCCGGTGTGACCCTGCATTGCTC
ACGCACGAAGCTGAGTGGGAGTTGGTGAAGGCGCTTGCACGTTTCCCTGC
GTGTGTCACGCGCGCTGCACAGGGACATGATCCGAGCGTTATTACCGGGT
ATCTCTATACACTCTCAAAAAGCTTCAGTCGCTTCTATCATGATTGTCCC
ATTCTGTGTGAAGCACGACCGGACTACGCGTGTGCAAGGCTTGAACTTGT
GCGTGCGGTGCGCATAGTGCTGAGAACAGCTATGCGTCTGGTGCTGATTC
CTTTTCTTGAAGAGATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy