Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR597 IGR598 IGR600 IGR599 TP0832 tyrS, - TP0834 argS, - TP0831 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 TP0832 tyrS, - TP0834 argS, - TP0831 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 Type: tandem, Name:  - 186 TP0832 tyrS, - TP0834 argS, - TP0831 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 dxs, - TP0824 TP0826 TP0825 TP0827 TP0826
* Calculated from Protein Sequence

Gene ID: TP0830

DNA Molecule Name:
1  

Genbank ID:
3323141

Gene Name:
hisT  

Definition:
pseudouridylate synthase I

Gene Start:
896627

Gene Stop:
897466

Gene Length:
840

Molecular Weight*:
31988

pI*:
10.77

Net Charge*:
23.51

EC:
4.2.1.70  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
This protein is involved in the formation of pseudouridine in the
anticodon stem and loop of tRNAs.

Reaction:
URACIL + D-RIBOSE 5-PHOSPHATE = PSEUDOURIDINE 5'-PHOSPHATE + H(2)O.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to pseudouridylate
synthase. For example residues 4-236 are 40% similar to pseudouridylate
synthase I of Borrelia burgdorferi,(AE001115).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0101
COG name: Pseudouridylate synthase (tRNA psi55)
Functional Class:  J
The phylogenetic pattern of COG0101 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 11-125 are 44% similar to pseudouridylate synthase of
TRUA_HAEIN. Residues 145-262 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 113 (E-value = 1.2e-34) place TP0830 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)
Residues 152 to 247 (E-value = 1.1e-14) place TP0830 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)

PDB Hit:
none

Gene Protein Sequence:
MNDVRKILLRISYDGTRFCGWQKQVSGSRERAPSVQGELEKVAEKIHHQK
IAVIGSGRTDSGVHAVGQAAHFCTPMRNILAYRFIPAFNSLLPHSIRITD
AREVSSQLHARFSAVMRTYRYHLHCAPVAYAHELPYCWHIARMPDIHLLN
QYAATLKGELDCTSFAAAGDKSASKSRYFYDTHFSFNHRVLTFEISANAF
LWKMVRSLTGTLLHCEKKRCSVREFVRILHAKDRRLQGPPHRRMGYSYGT
SVTPNTYSVQNRNTLARELASTGNARWKTY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGATGTGCGCAAAATTCTCTTGCGTATTTCGTACGATGGAACACG
ATTTTGCGGATGGCAAAAACAGGTCTCAGGCTCACGGGAACGTGCTCCCT
CTGTCCAAGGTGAGTTGGAAAAAGTTGCTGAGAAAATTCACCACCAAAAG
ATAGCAGTCATCGGTTCAGGGAGAACAGACTCTGGCGTACACGCAGTAGG
ACAGGCAGCACATTTTTGTACCCCCATGAGAAATATACTCGCGTATCGCT
TTATCCCTGCATTTAATTCGCTGCTCCCGCACTCCATTCGCATTACAGAC
GCACGCGAAGTCTCCTCTCAACTCCACGCACGCTTCTCTGCCGTCATGCG
CACGTACCGTTACCACCTCCACTGCGCACCCGTCGCATACGCGCACGAAC
TGCCTTACTGCTGGCACATTGCGAGAATGCCCGATATACACTTGCTCAAT
CAATATGCTGCAACACTCAAGGGAGAACTAGACTGCACAAGCTTTGCTGC
TGCAGGAGATAAAAGTGCGAGTAAATCGCGTTATTTTTACGACACACACT
TTTCTTTCAACCATCGCGTACTGACCTTCGAAATCTCTGCTAATGCCTTT
CTCTGGAAAATGGTGCGCTCTCTTACAGGAACCCTACTACACTGCGAAAA
GAAGCGGTGCTCCGTGCGCGAATTCGTCCGCATTTTGCACGCGAAAGACA
GGCGCTTGCAGGGCCCACCGCACCGCCGCATGGGCTATTCCTATGGAACA
TCCGTTACCCCGAACACTTACTCCGTGCAGAATAGGAACACCCTCGCACG
TGAACTGGCATCCACAGGCAATGCAAGGTGGAAGACGTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy