Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR597 IGR598 IGR599 IGR595 IGR596 rbo,dfx, - TP0823 TP0832 TP0822 argS, - TP0831 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 rbo,dfx, - TP0823 TP0832 TP0822 argS, - TP0831 TP0825 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 Type: tandem, Name:  - 186 TP0832 TP0822 argS, - TP0831 rbo,dfx, - TP0823 acpS, - TP0828 TP0833 hisT, - TP0830 TP0829 dxs, - TP0824 TP0826 TP0825 TP0827 TP0826
* Calculated from Protein Sequence

Gene ID: TP0828

DNA Molecule Name:
1  

Genbank ID:
3323139

Gene Name:
acpS  

Definition:
holo-acyl-carrier protein synthase

Gene Start:
895372

Gene Stop:
895746

Gene Length:
375

Molecular Weight*:
14102

pI*:
9.42

Net Charge*:
3.15

EC:
2.7.8.7  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein transfers the 4'-phosphopantetheine moiety from coenzyme A
to the Ser-36 of acyl-carrier protein.

Reaction:
COA + APO-[ACYL-CARRIER PROTEIN] =
ADENOSINE 3',5'-BISPHOSPHATE + HOLO-[ACYL-CARRIER PROTEIN].

This protein seems to have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle and C-terminal region had four
significant hits to holo-acyl-carrier protein synthases. For example
residues 23-121 are 41% similar to ACPS_ECOLI,holo-acyl-carrier protein
synthase of E. coli,(AE000343).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0736
COG name: Acyl-carrier protein synthase
Functional Class:  I
The phylogenetic pattern of COG0736 is ----Yqv-ebr-uj-polinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 23-121 are 41% similar to holo-acyl-carrier protein synthase
of ACPS_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 70 (E-value = 2.8e-11) place TP0828 in the ACPS family which is described as 4'-phosphopantetheinyl transferase superfamily (PF01648)

PDB Hit:
none

Gene Protein Sequence:
MIIGVGIDIVEIERFVSWTHNVRLLRRFFHQEEIVDFFKNHMRAQFLATR
FAAKEAFGKALGTGLRNMELRNIRVCQNGWGKPRLEVYGAAQAMLAATGG
THIQVSLTHEREVASAIVIIEGEPL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCATTGGCGTGGGAATAGACATAGTAGAAATAGAACGATTCGTATC
TTGGACACACAACGTGCGCCTGCTCCGTCGCTTCTTTCATCAAGAGGAGA
TTGTAGACTTTTTTAAAAACCACATGCGAGCGCAGTTTCTTGCCACGCGC
TTTGCCGCAAAGGAAGCATTTGGAAAGGCACTCGGTACGGGACTCAGAAA
CATGGAGCTAAGGAATATTCGGGTGTGTCAAAATGGATGGGGTAAGCCGA
GACTAGAAGTCTACGGTGCTGCACAGGCTATGTTGGCTGCAACAGGAGGC
ACGCATATACAGGTGTCGCTAACGCATGAGAGAGAAGTCGCCTCAGCCAT
CGTGATTATCGAGGGAGAACCGCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy