Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR597 IGR592 IGR594 IGR595 IGR593 IGR596 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 argS, - TP0831 TP0825 acpS, - TP0828 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 argS, - TP0831 TP0825 acpS, - TP0828 hisT, - TP0830 TP0829 TP0827 dxs, - TP0824 Type: tandem, Name:  - 186 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 acpS, - TP0828 hisT, - TP0830 TP0829 dxs, - TP0824 TP0826 TP0825 TP0827 TP0826
* Calculated from Protein Sequence

Gene ID: TP0824

DNA Molecule Name:
1  

Genbank ID:
3323137

Gene Name:
dxs  

Definition:
1-deoxyxylulose 5-phosphate synthase

Gene Start:
891553

Gene Stop:
893442

Gene Length:
1890

Molecular Weight*:
0

pI*:
8.15

Net Charge*:
9.33

EC:
4.1.3.37  

Functional Class:
Unknown  

Pathway: pathway table

Comment:
CATALYZES THE ACYLOIN CONDENSATION REACTION BETWEEN C ATOMS 2 AND 3 OF
PYRUVATE AND GLYCERALDEHYDE 3-PHOSPHATE TO YIELD
1-DEOXY-D-XYLULOSE-5-PHOSPHATE (DXP).

IN THE BIOSYNTHETIC PATHWAY TO ISOPRENOIDS, THIAMIN, AND
PYRIDOXOL.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to 1-deoxyxyulose-5-phosphate
synthase proteins. For example residues 14-621 are 39% similar to
DXS_ECOLI, D-1-deoxyxylulose 5-phosphate synthase of Escherichia coli,
(AF035440).

COGS Summary:  COGS Search
BeTs to 10 clades of COG1154
COG name: Deoxyxylulose-5-phosphate synthase
Functional Class:  H,I
The phylogenetic pattern of COG1154 is -m---qVcebRhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 138-177, 358-378, 415-450, and 503-534 represent significant
(99%) hits to blocks BL00801E,F,G,H, Transketolase proteins.

ProDom Summary:  Protein Domain Search
Residues 9-117 are 66% similar to YPUX_RHOCA, a hypothetical protein
of RHODOBACTER CAPSULATUS with similarity to 1-deoxy-xyulose-5-phosphate
synthase proteins. Residues 144-200, 182-315, 242-323, 321-496,
352-438, and 439-532 match well to hypothetical proteins and
transketolases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 316 to 479 (E-value = 1.1e-61) place TP0824 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 491 to 614 (E-value = 2.5e-33) place TP0824 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
79  
239

PDB Hit:
none

Gene Protein Sequence:
MDLSLLRSLTGPHDLKSLSPEQVRALAQEVRQEILRVVSANGGHLASNLG
VVELTIALHRVFSCPHDVVVWDVGHQCYAHKLLTGRAGRFHTLRQKDGIS
GFPRRDESPYDAFGTGHSSTALSAASGILSALRYRGKSGKVVAVVGDGAL
TAGLAFEALLNVGRSCSDLIVILNDNKMSISPNTGSFSRYLSTLTVKGPY
QKLKTRLRRALQTVPLVGRPACRALSRLKRSARTLLYQSNIFADFGFEYV
GPLNGHHIEDLERVLNDAKKLTRPTLLHVQTVKGKGYPFAEQNPTDFHGV
GPFNLAEGIVEKKDALTFTEAFSHTLLNAARTDDRVVAITAAMTGGTGLG
LFSHIYPERFFDVGIAEQHAVTFAAGLACAGVKPVVAVYSTFLQRAVDQV
IHDVAVQNLPVIFALDRAGAVPHDGETHQGLFDLSILRAVPNINILCPAS
AHELSLLFGWALAQDTPVAIRYPKALCPPEEDGFSTPVHTGRGVLITREN
ECNVLLVCTGGVFPEVTAAANTLARKGIFADIYNVRFVKPVDEDYFLDLV
GRYRSVLFVEDGVKIGGIAEALQALLNTRHPAPCSDVLAFQDMFYPHGSR
AQVLAAAGLSAPHIAARAEWLLAHSVGQIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTGTCGCTGCTTCGCTCCCTCACTGGGCCCCACGATCTTAAGAG
TCTCTCCCCCGAGCAGGTGCGCGCGCTCGCGCAGGAGGTACGCCAGGAGA
TCTTGCGCGTTGTCAGTGCCAATGGTGGTCATCTTGCCAGTAACCTCGGT
GTCGTCGAGCTCACCATCGCACTCCACCGCGTCTTTTCCTGTCCCCACGA
CGTTGTCGTTTGGGATGTCGGTCATCAGTGCTACGCGCACAAGCTCCTCA
CTGGACGCGCAGGGCGCTTCCATACCCTCCGCCAGAAGGATGGTATTTCG
GGGTTCCCGCGGCGCGATGAAAGCCCGTACGACGCTTTTGGTACCGGTCA
CTCTTCCACGGCACTTTCTGCCGCAAGTGGTATCCTCAGCGCCCTACGAT
ACCGGGGTAAATCAGGTAAGGTAGTCGCTGTCGTAGGAGACGGCGCACTC
ACCGCGGGCCTCGCCTTCGAGGCCCTCCTGAATGTGGGCCGTTCCTGCAG
TGATCTCATCGTCATCCTCAACGACAACAAAATGTCCATTAGCCCCAATA
CGGGGTCCTTTTCCCGCTACCTGAGTACCCTCACGGTAAAAGGTCCATAC
CAGAAGCTCAAAACGCGGCTTCGCCGCGCGCTCCAGACTGTCCCACTCGT
CGGTCGCCCCGCCTGCCGCGCCCTCAGCCGCCTGAAACGAAGTGCAAGAA
CGCTTTTGTACCAGTCAAATATTTTCGCAGACTTTGGATTCGAGTACGTC
GGTCCCTTAAATGGACACCATATCGAAGATCTTGAGCGCGTACTCAACGA
CGCTAAAAAACTCACCCGTCCCACTCTCCTCCACGTGCAGACTGTAAAGG
GAAAAGGCTACCCCTTTGCGGAGCAGAATCCTACCGATTTCCACGGCGTA
GGACCGTTTAACCTTGCAGAAGGAATAGTAGAAAAAAAGGATGCGCTCAC
CTTTACCGAAGCCTTCTCCCATACCCTCCTAAATGCAGCGCGTACTGATG
ACCGTGTTGTCGCTATCACCGCTGCTATGACTGGCGGCACCGGGCTTGGA
TTGTTTTCCCATATATACCCTGAACGCTTCTTCGATGTTGGCATTGCTGA
GCAACATGCGGTCACGTTCGCCGCAGGGCTTGCATGCGCCGGCGTAAAAC
CTGTCGTTGCCGTCTACAGTACGTTTTTGCAGCGCGCCGTTGATCAGGTT
ATTCACGATGTTGCTGTGCAGAATCTGCCGGTCATTTTTGCGCTTGACCG
CGCAGGTGCCGTACCCCACGATGGGGAAACACACCAGGGCCTGTTTGATC
TCAGCATTCTTCGCGCTGTTCCGAACATAAACATCCTGTGCCCTGCGTCG
GCGCACGAGCTTTCGTTGCTCTTTGGCTGGGCGCTTGCACAGGACACCCC
CGTAGCTATCCGCTATCCTAAGGCGTTATGTCCACCTGAAGAAGACGGAT
TCAGTACACCTGTACATACCGGACGCGGCGTCCTTATCACCCGAGAGAAT
GAGTGCAATGTACTGTTAGTGTGCACAGGGGGCGTTTTTCCCGAGGTAAC
CGCTGCGGCCAACACTCTTGCGCGAAAGGGCATATTTGCAGATATCTACA
ACGTGCGCTTCGTAAAGCCGGTAGACGAAGATTACTTTTTAGATCTTGTA
GGTCGCTACCGTTCCGTTCTTTTTGTCGAAGACGGCGTAAAAATCGGAGG
AATTGCAGAAGCGCTCCAGGCACTCTTGAACACCAGGCACCCGGCTCCGT
GCAGCGACGTGCTTGCTTTTCAGGACATGTTCTACCCGCATGGTTCGCGC
GCGCAGGTACTCGCCGCAGCAGGCCTTTCTGCACCGCATATTGCCGCACG
CGCAGAATGGCTGTTAGCCCATTCAGTTGGGCAGATTCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy