Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR591 IGR592 IGR594 IGR595 IGR593 IGR596 TP0818 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 eno, - TP0817 TP0825 acpS, - TP0828 TP0829 TP0827 dxs, - TP0824 TP0818 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 eno, - TP0817 TP0825 acpS, - TP0828 TP0829 TP0827 dxs, - TP0824 Type: tandem, Name:  - 185 rbo,dfx, - TP0823 TP0820 tpn32, - TP0821 TP0822 TP0819 eno, - TP0817 TP0818 TP0829 dxs, - TP0824 TP0826 TP0825 TP0827 acpS, - TP0828 TP0826
* Calculated from Protein Sequence

Gene ID: TP0823

DNA Molecule Name:
1  

Genbank ID:
3323136

Gene Name:
rbo  dfx  

Definition:
desulfoferrodoxin

Gene Start:
891156

Gene Stop:
890773

Gene Length:
384

Molecular Weight*:
13786

pI*:
6.23

Net Charge*:
-2.71

EC:
1.18.1.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is a non-heme iron protein. It contains two types of
iron atoms per molecule: a desulforedoxin-like FES(4) site and an
octahedral coordinated high-spin ferrous site most probably with
nitrogen/ oxygen-containing ligands.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to desulfoferrodoxin
proteins. For example residues 20-128 are 39% similar to desulfoferrodoxin
of Desulfovibrio vulgaris,(M28848).

COGS Summary:  COGS Search
BeTs to 6 clades of COG2033
COG name: Desulfoferrodoxin
Functional Class:  C
The phylogenetic pattern of COG2033 is Amtk--v----------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 58-80 represent a significant (98%) hit to block PR00851F,
XERODERMA PIGMENTOSUM GROUP B PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 41-25 are 43% similar to desulfoferrodoxin of DESR_DESVH.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 42 to 128 (E-value = 2.7e-46) place TP0823 in the Desulfoferrodox family which is described as Desulfoferrodoxin (PF01880)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
71

PDB Hit:
none

Gene Protein Sequence:
MGRELSFFLQKESAGFFLGMDAPAGSSVACGSEVLRAVPVGTVDAAKEKH
IPVVEVHGHEVKVKVGSVAHPMTPEHYIAWVCLKTRKGIQLKELPVDGAP
EVTFALTADDQVLEAYEFCNLHGVWSGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGACGGGAGTTGTCGTTTTTCTTGCAGAAGGAAAGTGCGGGATTTTT
TCTCGGTATGGATGCGCCTGCAGGCAGTAGTGTCGCGTGCGGCAGTGAGG
TGCTGCGTGCAGTGCCTGTAGGTACAGTGGATGCAGCGAAGGAAAAGCAT
ATCCCCGTGGTAGAAGTGCACGGACACGAGGTAAAGGTGAAGGTGGGGAG
TGTGGCTCACCCAATGACGCCGGAGCATTACATTGCGTGGGTGTGCCTCA
AGACCCGGAAGGGTATTCAGCTCAAGGAACTTCCGGTAGATGGAGCGCCT
GAGGTGACCTTTGCACTGACAGCAGACGATCAGGTGCTCGAAGCCTATGA
GTTTTGTAACCTGCACGGGGTGTGGTCAGGTAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy