Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR591 IGR592 IGR585 IGR586 IGR589 IGR588 IGR590 IGR587 TP0811 TP0818 TP0816 TP0820 TP0819 TP0813 eno, - TP0817 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812 TP0811 TP0818 TP0816 TP0820 TP0819 TP0813 eno, - TP0817 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812 Type: tandem, Name:  - 184 Type: tandem, Name:  - 185 Type: tandem, Name:  - 299 TP0811 TP0816 TP0819 TP0813 eno, - TP0817 TP0818 TP0820 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812
* Calculated from Protein Sequence

Gene ID: TP0814

DNA Molecule Name:
1  

Genbank ID:
3323124

Gene Name:
trxB  

Definition:
thioredoxin reductase

Gene Start:
882687

Gene Stop:
883607

Gene Length:
921

Molecular Weight*:
0

pI*:
5.69

Net Charge*:
-5.54

EC:
1.6.4.5  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Shang ES, Skare JT, Erdjument-Bromage H, Blanco DR, Tempst P, Miller JN, Lovett, MA. 1997. Sequence analysis and characterization of a 40-kilodalton Borrelia hermsii glycerophosphodiester phosphodiesterase homolog. J Bacteriol Apr;179(7):2238-46. Medline: 97234635.

Comment:
This protein is induced by several general stress factors including
heat shock, salt stress, oxidative stress, glucose limitation and
oxygen limitation.

Reaction:
NADPH + OXIDIZED THIOREDOXIN = NADP(+) + REDUCED THIOREDOXIN.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to thioredoxin reductase
proteins. For example residues 2-306 are 42% similar to TRXB_LISMO,
thioredoxin reductase of Listeria monocytogenes,(AF009622).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0492
COG name: Thioredoxin reductase/alkyl hydroperoxide reductase
Functional Class:  O
The phylogenetic pattern of COG0492 is amtkYQVcEBrhUJgpolinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 9-30, 149-170, 39-53, 104-121, 129-173, 130-174, 232-258,
and 265-302 represent significant (100%) hits to blocks
BL00573A,B,C,D,E,F, Pyridine nucleotide-disulphide oxidoreductases
class-II active. Residues 6-28 and 146-168 represent significant (99%)
hits to blocks PR00420A, AROMATIC-RING HYDROXYLASE (FLAVOPROTEIN
MONOOXYGENASE) SIGNATURE. Residues 6-25 and 146-165 represent
significant (99%) hits to block PR00757A, FLAVIN-CONTAINING AMINE
OXIDASE SIGNATURE. Residues 6-20, 11-61, and 97-147 represent
significant (99%) hits to blocks BL00504A,F, Fumarate reductase / succinate
dehydrogenase FAD-binding site proteins. Residues 6-28, 146-168,
147-161, and 7-21 represent significant (99%) hits to blocks PR00419A,D
ADRENODOXIN REDUCTASE FAMILY SIGNATURE. Residues 8-39, 148-179,
212-244 represent significant (98%) hits to blocks BL00982A,D,
Bacterial-type phytoene dehydrogenase proteins. Residues 5-34, 145-174,
and 257-305 represent significant (98%) hits to blocks BL00076A,D,
Pyridine nucleotide-disulphide oxidoreductases class-I. Residues
6-21, 145-163, and 5-23 represent significant (98%) hits to blocks
PR00370A,D, FLAVIN-CONTAINING MONOOXYGENASE (FMO) SIGNATURE. Residues
6-47 and 146-187 represent significant (95%) hits to block BL01280A,
Glucose inhibited division protein A family proteins.

ProDom Summary:  Protein Domain Search
Residues 107-245 are 49% similar to REDUCTASES and DEHYDROGENASES as
represented by TRXB_STRCL. Residues 48-92 and 250-277 also support
this match. Residues 63-278 are 31% similar to YPDA_BACSU, a
hypothetical protein of B. subtilis.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0735, glutamate synthase
and TP0921, NADH oxidase. Residues 3-302 are 27% similar to TP0735
and residues 7-307 are 24% similar to TP0921.

Pfam Summary:  Pfam Search
Residues 6 to 286 (E-value = 3.2e-80) place TP0814 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)

PDB Hit:
None

Gene Protein Sequence:
METDYDVIIVGAGAAGLSAAQYACRANLRTLVIESKAHGGQALLIDSLEN
YPGYATPISGFEYAENMKKQAVAFGAQIAYEEVTTIGKRDSVFHITTGTG
AYTAMSVILATGAEHRKMGIPGESEFLGRGVSYCATCDGPFFRNKHVVVI
GGGDAACDESLVLSRLTDRVTMIHRRDTLRAQKAIAERTLKNPHIAVQWN
TTLEAVRGETKVSSVLLKDVKTGETRELACDAVFFFIGMVPITGLLPDAE
KDSTGYIVTDDEMRTSVEGIFAAGDVRAKSFRQVITATSDGALAAHAAAS
YIDTLQN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGACAGATTACGACGTTATCATCGTAGGCGCTGGGGCCGCGGGACT
GTCCGCAGCGCAGTACGCATGTCGCGCCAATCTCAGGACCCTTGTGATTG
AGAGCAAGGCACACGGTGGTCAAGCATTGCTTATTGATTCGTTGGAAAAC
TATCCGGGTTATGCAACTCCTATCAGTGGCTTCGAGTACGCGGAAAACAT
GAAAAAGCAGGCAGTTGCCTTTGGGGCTCAGATTGCTTACGAAGAAGTTA
CCACTATCGGTAAGCGCGATAGCGTTTTCCACATTACCACGGGTACGGGA
GCATATACGGCGATGTCTGTTATTCTTGCCACCGGTGCAGAGCATCGCAA
GATGGGCATCCCGGGGGAGAGTGAGTTTTTAGGCCGTGGCGTTTCCTATT
GTGCCACCTGCGATGGACCCTTCTTTAGAAACAAGCACGTGGTGGTCATT
GGTGGGGGTGACGCTGCGTGTGATGAATCGCTAGTACTGTCTCGCCTCAC
CGATCGGGTGACGATGATTCACCGCAGGGACACTCTGCGTGCACAGAAGG
CCATTGCAGAGCGCACACTTAAAAATCCACATATTGCCGTTCAATGGAAC
ACTACGCTTGAAGCGGTACGTGGTGAAACGAAAGTTTCCTCCGTTCTGCT
TAAGGATGTTAAGACGGGAGAAACGCGAGAGCTCGCGTGTGATGCTGTTT
TCTTCTTCATCGGTATGGTTCCCATCACCGGTCTTTTGCCCGACGCAGAA
AAGGATTCCACCGGTTATATCGTCACCGACGACGAGATGCGTACCTCTGT
AGAGGGGATTTTCGCTGCGGGGGATGTGCGCGCTAAGTCTTTCCGGCAGG
TTATTACTGCTACTTCGGATGGTGCCCTTGCCGCGCACGCCGCCGCGAGT
TACATCGACACACTCCAAAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy