Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR585 IGR584 IGR586 IGR589 IGR588 IGR583 IGR590 IGR587 TP0811 TP0816 TP0813 femA,femB, - TP0806 rnb, - TP0805 rpmF, - TP0807 acpP, - TP0808 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812 TP0811 TP0816 TP0813 femA,femB, - TP0806 rnb, - TP0805 rpmF, - TP0807 acpP, - TP0808 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812 Type: tandem, Name:  - 184 Type: tandem, Name:  - 299 TP0811 TP0816 TP0813 femA,femB, - TP0806 rnb, - TP0805 acpP, - TP0808 rnc, - TP0809 dam, - TP0810 trxB, - TP0814 TP0815 TP0812 rpmF, - TP0807
* Calculated from Protein Sequence

Gene ID: TP0812

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
long-chain-fatty-acid--CoA ligase (authentic frameshift - corrected)

Gene Start:
879757

Gene Stop:
881422

Gene Length:
0

Molecular Weight*:
0

pI*:
0.00

Net Charge*:
0.00

EC:
6.2.1.3  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
In E. coli this protein is involved in esterification, concomitant with
transport, of exogenous long-chain fatty acids into metabolically active
CoA thioesters for subsequent degradation or incorporation into
phosopholipids. This enzyme requires magnesium as a cofactor.

Reaction:
ATP + A LONG-CHAIN CARBOXYLIC ACID + COA =
AMP + PYROPHOSPHATE + AN ACYL-COA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to acyl-CoA ligases.
For example residues 13-501 are 24% similar to a possible long-chain
acyl-CoA synthetase of Bacillus subtilis,(Z99113). In addition,
197-489 are 24% similar to LCF3_YEAST, long-chain-fatty-acid--CoA
ligase of Saccharomyces cerevisiae,(Z29647).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0318
COG name: Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Functional Class:  I
The phylogenetic pattern of COG0318 is A-t-Y---EBRh------inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 274-288 represent a significant (97%) hit to block PR00833H,
POLLEN ALLERGEN POA PI SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 395-490 are 32% similar to fatty acid ligase as represented
by LCFA_RAT. Residues 49-127 and 197-266 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0145, long-chain-fatty-acid--CoA
ligase. Residues 64-449 are 21% similar to TP0145.

Pfam Summary:  Pfam Search
Residues 49 to 486 (E-value = 5.9e-39) place TP0812 in the AMP-binding family which is described as AMP-binding enzyme (PF00501)

PDB Hit:
none

Gene Protein Sequence:
MPAMYSRRGTVPHLTFEAALRHCAQHFGSQNAVCFLGHATDAHSRCCLNY
RLFAQRVRRARQLLMRCGVRAGSCVALFGPNCPQWGVSYFAIVSLGARAV
PLVPELSPQELRRCLQHAHVCCVIAGAAERETLAQADTLTDPDAASCSAK
DGQDLSTVSHTAQRTLIALEDFSLVCTTDGVQNTPVPVTHWKNAGSDPDA
IASVVYTSTGGAGTPPRAVTFTQRNLLCTARYAQRVLRVRTHDVVFSLLP
LAHLFEFVCAFLAVFFTGCLRVVCTSTPTDAVATAAIAMRKADVAFLSPT
FSGGFRAAAFAPPLCSAAPYPTWRTAAPLGSLERRVQXEHTQILHRISLE
AVLFHGYLHASVLIFVTAKKNTKDKDMPAPRTQTRAVPGLKTRLLNYNAF
TSTGELALRGEGVTPGYWRDEVRTRAAFTPDGWLRTGTLWTKTETGNLLP
CSSSCHMQLGARGEAVYAEDLVCVLMQHPCVVHAHVRVDTQGQAHCAVWV
KQGAERIRHPQIVCFLRTQLSTQVRVGTLRVMEYEKTVGADRLSRRDTPF
LKENSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCGCCATGTACAGTCGAAGGGGAACCGTGCCACATCTTACCTTTGA
AGCGGCACTCAGACACTGTGCCCAGCACTTTGGATCTCAAAATGCAGTCT
GCTTCCTAGGCCATGCTACGGACGCGCATTCGCGGTGCTGCTTGAACTAC
CGTCTCTTTGCACAGCGTGTGCGCCGTGCACGCCAGTTGCTGATGCGCTG
TGGTGTGCGCGCAGGAAGCTGCGTTGCGCTCTTTGGCCCCAACTGTCCAC
AGTGGGGAGTTAGCTACTTTGCAATAGTAAGCCTTGGTGCCCGCGCAGTC
CCTCTCGTACCAGAGCTCAGTCCGCAGGAGCTGCGCCGCTGCCTCCAGCA
TGCTCACGTTTGCTGTGTCATTGCGGGCGCTGCAGAAAGAGAAACACTCG
CCCAAGCGGATACACTCACCGATCCGGACGCTGCTTCTTGCTCCGCAAAA
GACGGGCAGGACCTTTCTACCGTATCGCACACCGCGCAAAGAACACTGAT
CGCTCTGGAAGATTTCTCCCTTGTCTGCACAACGGACGGTGTACAAAACA
CTCCAGTACCTGTGACGCACTGGAAGAATGCTGGATCAGACCCGGATGCC
ATTGCCAGCGTGGTGTACACCAGCACCGGAGGCGCTGGCACTCCTCCCCG
TGCCGTAACATTTACCCAACGGAATTTACTGTGCACCGCGCGATATGCAC
AGCGTGTACTGCGTGTACGCACGCACGATGTGGTTTTTTCGCTCCTCCCC
CTTGCACACTTATTCGAGTTCGTGTGTGCGTTTCTTGCAGTTTTTTTTAC
AGGGTGCCTGCGTGTGGTATGCACCTCCACTCCCACAGATGCGGTTGCCA
CTGCAGCAATTGCAATGCGTAAAGCCGACGTTGCTTTTCTGTCTCCCACC
TTTTCTGGAGGCTTCCGAGCAGCTGCGTTCGCGCCGCCCCTGTGCTCGGC
AGCTCCATACCCAACTTGGAGGACAGCTGCGCCTCTTGGTTCTCTGGAGC
GAAGAGTGCAG--TGAACACACGCAGATTTTGCACCGGATCTCGCTGGAA
GCGGTGCTCTTTCACGGGTATCTACATGCGAGCGTGCTCATTTTTGTGAC
CGCAAAGAAAAATACAAAAGACAAAGACATGCCGGCGCCACGCACTCAGA
CGCGTGCGGTGCCCGGTTTAAAAACGCGCCTTTTAAACTACAACGCGTTC
ACCAGCACCGGGGAACTTGCCTTACGGGGAGAGGGTGTAACACCCGGCTA
TTGGCGCGATGAGGTACGCACACGTGCAGCGTTTACTCCCGACGGCTGGC
TCCGTACAGGGACGCTTTGGACAAAGACAGAAACCGGTAATCTCCTCCCC
TGCAGCAGCTCGTGCCATATGCAACTCGGTGCGCGCGGAGAAGCGGTGTA
CGCAGAGGATCTTGTTTGTGTGCTTATGCAACATCCGTGCGTGGTGCACG
CACACGTGCGCGTAGACACGCAAGGGCAAGCGCACTGCGCCGTATGGGTA
AAACAAGGAGCCGAACGAATACGGCACCCTCAGATAGTGTGCTTTTTGCG
CACCCAGCTTTCCACGCAGGTGCGCGTGGGGACGCTTCGGGTGATGGAGT
ATGAAAAAACAGTAGGTGCTGACCGCTTGTCTCGACGCGACACACCTTTC
CTAAAGGAAAACTCTTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy