Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR581 IGR585 IGR580 IGR584 IGR586 IGR582 IGR583 femA,femB, - TP0806 rnb, - TP0805 clpA, - TP0801 rpmF, - TP0807 acpP, - TP0808 TP0802 rnc, - TP0809 dam, - TP0810 TP0804 TP0803 femA,femB, - TP0806 rnb, - TP0805 clpA, - TP0801 rpmF, - TP0807 acpP, - TP0808 TP0802 rnc, - TP0809 dam, - TP0810 TP0804 TP0803 Type: tandem, Name:  - 299 femA,femB, - TP0806 rnb, - TP0805 clpA, - TP0801 acpP, - TP0808 TP0802 rnc, - TP0809 dam, - TP0810 TP0804 TP0803 rpmF, - TP0807
* Calculated from Protein Sequence

Gene ID: TP0805

DNA Molecule Name:
1  

Genbank ID:
3323115

Gene Name:
rnb  

Definition:
ribonuclease II

Gene Start:
875761

Gene Stop:
873485

Gene Length:
2277

Molecular Weight*:
84108

pI*:
7.19

Net Charge*:
2.92

EC:
3.1.13.1  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Zilhão R, Cairrão F, Régnier P, Arraiano CM.
PNPase modulates RNase II expression in Escherichia coli: implications for mRNA decay and cell metabolism.
Mol Microbiol. 1996 Jun;20(5):1033-42.
PMID: 8809756

Zilhão R, Plumbridge J, Hajnsdorf E, Régnier P, Arraiano CM.
Escherichia coli RNase II: characterization of the promoters involved in the transcription of rnb.
Microbiology. 1996 Feb;142 ( Pt 2):367-75.
PMID: 8932710

Zilhão R, Régnier P, Arraiano CM.
The role of endonucleases in the expression of ribonuclease II in Escherichia coli.
FEMS Microbiol Lett. 1995 Aug;130(2-3):237-44.
PMID: 7649446

Comment:
This protein is involved in mRNA degradation. It hydrolyses single-
stranded polyribonucleotides processively in the 3' to 5' direction.

Reaction:
EXONUCLEOLYTIC CLEAVAGE IN THE 3' TO 5' DIRECTION TO YIELD
5'-PHOSPHOMONONUCLEOTIDES.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to many different
proteins including VacB proteins and ribonuclease II proteins, however
they all belonged to the ribonuclease II family. For example residues
154-635 are 29% similar to ribonuclease II of Synechocystis sp.,(D90904).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0557
COG name: Exoribonucleases
Functional Class:? K
The phylogenetic pattern of COG0557 is ----YqvCEb-Hujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 274-301, 319-355, 475-484, and 546-563 represent sigificant
(100%) hits to blocks BL01175A,B,C,D, Ribonuclease II family proteins.

ProDom Summary:  Protein Domain Search
Residues 300-489 are 30% similar to mitotic control protein of
DIS3_SCHPO, which belongs to the ribonuclease II (Rnb) family.
Residues 505-563 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 213 to 568 (E-value = 3.9e-101) place TP0805 in the RNB family which is described as RNB-like protein (PF00773)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
138  
167

PDB Hit:
none

Gene Protein Sequence:
MMELHVGSPVLYRKRPACVHAIERGKDAKITIETEHGLRRVRVKDVLLLH
PGTVSSLVELLSASHIARISEESVQDAREFFGTEAPSFFELAELLWGASA
AQSWAYWEQSVQSAYFVCNEPAAAVRIRSQQECASCAVQEEKKEARQALK
QAFIQELRRVARSARNMAPTAQEGMHRVHVSQVNEQFTPFLQEIEAFALG
HANRCKILQCALGCEHREQAHEILLHFGFWPVYRNPYPDRLCPLFLSPAH
VSGSDGERAAQQDVHTHRCVTQARTDCTHLAAYAIDGEGTRDPDDAISFD
GTYFWIHVASPAELVLPDSHADACARTRGRSLYLPEGAVRMLSDVVVDTC
ALARDAVSPALSFKILLDEHGDISCVHVLRSMVRVTRLSYAEADSQRDTP
ALQPLFDFARNNIARRKGRGAVDICFPDVHMRVDFPVQETGQAGKEMNAG
DVPDTQGKVPRVHIEAQQSYESMSMVREFMLLAGEAAARFAFLHNLAFPY
VSQERPQLPVQLPAGLAGEYKKRRAMKARRVSTTAAVHAALGLSQYSQVT
SPLRRYVDLLAHQQLLACIDHAYAKAPAVGSAQTNETLALKLAQADEAAR
QATQAERVSRRHWTLVYFLMHPHTRYEAIVLEPLQPRAHVWLPAVALEAD
VALGRQAQFNERVMLRVVRVRLATLEVHFSVCEHCHRGVTQAVEGEAEQP
SXEEYVFGSVLFPCGYFRRCVYXSHLAGSSLQGVPGFCVKVQCFGQIECK
GXQSSLVCG

Gene Nucleotide Sequence:  Sequence Viewer
GTGATGGAACTACATGTGGGGAGTCCGGTGCTCTATCGAAAGCGCCCTGC
GTGTGTACACGCTATCGAGCGAGGGAAGGATGCGAAGATCACCATTGAAA
CCGAACACGGGTTAAGACGCGTGCGCGTGAAAGACGTTTTGCTCTTGCAC
CCGGGCACTGTTTCTTCCCTGGTAGAACTATTGTCTGCGTCTCACATTGC
GCGTATAAGCGAGGAATCCGTACAGGACGCGCGCGAGTTTTTCGGTACCG
AAGCTCCTTCCTTTTTTGAACTTGCAGAGCTCCTCTGGGGGGCTTCTGCC
GCGCAGTCGTGGGCCTATTGGGAGCAAAGTGTGCAAAGTGCGTATTTTGT
TTGCAATGAGCCTGCCGCCGCAGTGCGCATCCGCTCTCAGCAAGAGTGCG
CATCCTGCGCAGTGCAGGAAGAAAAAAAGGAAGCGCGTCAGGCGTTAAAG
CAGGCGTTCATCCAGGAGCTACGGCGCGTCGCACGAAGTGCACGCAATAT
GGCACCAACTGCGCAGGAAGGAATGCATCGTGTGCACGTGTCGCAGGTGA
ACGAGCAGTTTACGCCCTTTCTGCAGGAAATCGAAGCGTTCGCGTTGGGG
CACGCGAATCGCTGTAAGATTTTGCAGTGTGCCTTAGGCTGCGAGCACAG
GGAGCAAGCGCATGAAATACTCTTGCACTTCGGGTTCTGGCCGGTGTATC
GCAATCCGTATCCTGATCGTCTGTGTCCTCTATTTTTAAGTCCTGCTCAT
GTGTCTGGTTCTGATGGAGAACGTGCGGCGCAGCAAGATGTGCACACACA
TAGGTGTGTCACTCAAGCACGCACAGATTGTACGCATCTTGCCGCGTATG
CCATCGATGGGGAGGGTACGCGCGACCCTGACGATGCGATCAGTTTCGAT
GGTACGTATTTTTGGATCCATGTAGCGAGCCCTGCAGAGCTCGTTCTTCC
TGATTCGCACGCAGATGCATGCGCACGTACACGGGGTCGTTCGCTCTATT
TGCCTGAAGGCGCAGTGCGCATGCTCAGCGACGTGGTGGTTGATACGTGT
GCACTCGCGCGCGACGCAGTTTCTCCTGCACTGTCTTTTAAAATTTTACT
TGATGAGCACGGTGACATCAGCTGTGTGCACGTGCTCCGGAGCATGGTGC
GTGTTACGCGCCTTTCCTATGCGGAGGCGGATTCCCAGCGCGATACCCCC
GCGTTGCAGCCTCTTTTTGACTTTGCGCGCAACAACATTGCACGGAGAAA
AGGGCGCGGCGCAGTGGACATTTGCTTTCCTGATGTCCACATGAGGGTAG
ATTTTCCTGTGCAAGAAACAGGGCAAGCGGGAAAGGAAATGAACGCCGGG
GACGTGCCCGATACACAGGGAAAGGTGCCGCGTGTTCACATTGAAGCACA
GCAGTCGTACGAGTCTATGAGCATGGTGCGTGAATTCATGCTCTTAGCGG
GAGAAGCGGCAGCACGGTTTGCCTTTCTACATAACCTTGCCTTTCCTTAT
GTGAGTCAGGAACGTCCTCAGCTGCCCGTGCAACTACCAGCGGGATTGGC
GGGGGAGTACAAAAAGCGGCGCGCGATGAAAGCTCGTCGCGTGAGCACAA
CCGCCGCGGTGCACGCAGCACTCGGGCTGTCTCAGTACAGTCAGGTGACC
AGTCCTTTGCGTCGCTATGTGGATTTGCTTGCGCATCAACAATTACTGGC
GTGTATTGATCACGCGTATGCAAAAGCTCCTGCTGTAGGAAGTGCACAGA
CAAACGAGACGCTTGCGCTCAAGCTTGCGCAGGCAGATGAGGCAGCGCGC
CAGGCCACACAAGCAGAGCGTGTATCGCGTCGTCACTGGACGCTCGTATA
CTTTTTGATGCACCCACACACGCGGTACGAAGCGATTGTGTTGGAGCCAC
TGCAACCGCGTGCRCACGTGTGGTTACCTGCTGTTGCTCTTGAGGCGGAT
GTAGCATTAGGTCGGCAGGCGCAGTTCAACGAACGCGTAATGCTCCGTGT
CGTGCGTGTGCGCCTTGCCACGTTAGAAGTACATTTTTCTGTCTGCGAGC
ACTGTCACCGCGGCGTGACGCAGGCTGTAGAAGGTGAGGCGGAGCAGCCC
TCAKAAGAGGAGTATGTTTTCGGATCTGTGTTATTCCCCTGTGGATATTT
CAGGCGGTGCGTGTACRGTAGCCACTTGGCTGGTTCCTCCCTGCAGGGCG
TGCCCGGTTTCTGCGTCAAAGTACAGTGCTTTGGACAAATCGAGTGCAAG
GGTNAGCAAAGTTCCCTCGTGTGCGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy