Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR581 IGR577 IGR580 IGR579 IGR582 IGR578 rnb, - TP0805 clpA, - TP0801 metG, - TP0798 TP0799 TP0802 TP0804 TP0803 dac, - TP0800 rnb, - TP0805 clpA, - TP0801 metG, - TP0798 TP0799 TP0802 TP0804 TP0803 dac, - TP0800 Type: tandem, Name:  - 183 rnb, - TP0805 clpA, - TP0801 metG, - TP0798 TP0799 TP0802 TP0804 TP0803 dac, - TP0800
* Calculated from Protein Sequence

Gene ID: TP0801

DNA Molecule Name:
1  

Genbank ID:
3323113

Gene Name:
clpA  

Definition:
ATP-dependent Clp protease subunit A

Gene Start:
870793

Gene Stop:
868367

Gene Length:
2427

Molecular Weight*:
89322

pI*:
6.60

Net Charge*:
-6.48

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is the ATP-dependent specificity component of the ClpP
protease. It directs the protease to specific substrates. The primary
function of the ClpA-ClpP complex appears to be the degradation of
unfolded or abnormal proteins.

See TP0549 (clpC), TP0507 (clpP), TP0508 (clpX)
TP1041 (clpP), TP0071 (clpB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ATP-dependent Clp
protease subunit A. For example residues 4-774 are 44% similar to
CLPA_ECOLI, ATP-dependent Clp protease ATP-binding subunit ClpA of
E. coli,(AE000190).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0542
COG name: ATPases with chaperone activity, ATP-binding domain
Functional Class:  O
The phylogenetic pattern of COG0542 is --t-YQVCEBRhUJgpOLINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 224-269, 509-554, 276-315, 321-335, 340-382, 537-579, 410-452,
501-549, 561-609, 644-692, 382-430, 624-652, and 682-696 represent
significant (100%) hits to blocks BL00870A,B,C,D,E,F,G,H,I, CLPAB_1;
Chaperonins clpA/B proteins.

ProDom Summary:  Protein Domain Search
Residues 210-452 are 58% similar to ATP-dependent Clp protease
subunit A of CLPA_ECOLI. Residues 26-138, 465-505, 478-652, 499-524,
588-630, 631-655, 676-774, and 690-769 also support hits to ATP-dependent
proteases.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0549, TP0071, TP0508,
and TP0524 all of which are ATP-dependent proteases. Residues
194-777 are 41% similar to TP0549, residues 207-502 are 46% similar
and residues 456-777 are 41% similar to TP0071. Residues 534-782
are 23% similar to TP0508 and residues 536-652 are 25% similar to
TP0524.

Pfam Summary:  Pfam Search
Residues 16 to 66 (E-value = 1e-08) place TP0801 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 250 to 432 (E-value = 1e-06) place TP0801 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 535 to 760 (E-value = 2.8e-06) place TP0801 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
719  
809

PDB Hit:
none

Gene Protein Sequence:
MKIIISASVQIILDQAFDLARKRRHEYITAEHVLFSALAHPAALEIINLC
SADIALIHSNLSEFLKTQVPVDLSHTPSQSLGFQHLLKRAVLYCEANKKS
ALEVGDLLVSLLQAETNYASYYMRMSGMSTARLIEVIARVNGIRHGDKNV
SMGSNAQERYSESDDVGESAGHGPPLDGTEGDGNTADVHVHYEHCAHKRT
DADTHRYTVLEKYTVNLTERARRGELAPLIGRTQEIERTIQILCRRQKNN
PVHVGEAGVGKTAITEGLAQRIVRCDVPEALEGVEIFSLDMTSLLAGTKF
RGDFEERLKRLAEELEKKTQAILFIDEIHTVVGTGSGGSGGLDASNLLKP
LLSSGKIRCIGSTTYEEYTKHFRKDQALARRFQKIDIEEPSEEETLRILE
GIRTLYEDFHAVHYSDEALAAAVRLSVQYIQGRHLPDKAIDIIDEAGACA
KLSRGKHGTEGVCSVIGESDIDEIVAKIAKIPKQRVSASEIEKLRNFERS
ISEKIFGQGEAIDLVTRTLKRARVGLRVKHKPIANLLFVGATGVGKTELA
RTLAQELGIVLHRFDMSEYQEKHTVSRLIGSPPGYVGFEEGGLLTDAVRK
QPHAVLLLDEIEKAHPDIFNVLLQVMDYATLTDNQGRKADFRNVILIMTS
NAGARNMGVSLIGFHKGQVGTAVIDEAVERIFSPEFRNRLDAVIRFDALS
LETMERIARKELALVCEQLQKKHIRFDITDDALALLAERSHSGGSGARNV
ARLVEQEVANVLADLMLFGGVAEGDALRCTVKDRHAQCNFLRIECVQSSY
SGSIQDALG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTATCATCAGTGCTTCTGTGCAAATTATTCTTGATCAGGCCTT
TGATTTAGCGCGTAAGCGGCGTCACGAGTACATCACCGCAGAGCATGTTC
TTTTTTCTGCCCTTGCGCATCCTGCTGCGTTGGAAATTATCAATCTCTGT
AGCGCGGATATCGCGCTCATCCATAGTAATCTGTCAGAGTTTTTAAAAAC
ACAAGTTCCCGTTGACTTAAGTCATACTCCTTCTCAATCACTGGGTTTTC
AGCATCTGCTTAAGCGTGCAGTCTTGTATTGCGAGGCGAATAAAAAAAGT
GCTCTTGAAGTCGGAGATCTGTTGGTAAGTCTCCTCCAAGCGGAGACAAA
CTATGCTTCGTACTACATGCGTATGTCGGGTATGAGTACGGCGCGCTTGA
TTGAAGTAATAGCTCGTGTCAATGGCATCCGACACGGGGATAAGAATGTG
TCGATGGGGTCGAACGCGCAAGAAAGGTATTCAGAGTCAGACGACGTTGG
CGAATCTGCAGGGCACGGTCCTCCGCTCGATGGAACAGAGGGGGATGGTA
ACACAGCGGACGTACATGTGCACTATGAACACTGCGCGCATAAACGCACG
GATGCAGATACGCATCGGTATACGGTGCTGGAAAAGTATACGGTGAATCT
CACCGAACGTGCTCGTCGGGGAGAGCTTGCTCCGCTCATTGGGCGTACGC
AGGAAATTGAGCGGACGATTCAGATTTTGTGCCGGAGACAGAAGAATAAT
CCGGTACATGTGGGTGAAGCTGGTGTGGGAAAGACGGCAATTACTGAGGG
GCTTGCGCAACGTATCGTGCGGTGCGATGTGCCAGAGGCGTTAGAGGGAG
TAGAGATTTTTAGCCTTGATATGACAAGCCTGTTAGCAGGTACAAAGTTT
CGAGGGGATTTTGAAGAGCGGCTCAAGCGTCTTGCAGAAGAGTTGGAAAA
GAAAACACAAGCAATTCTTTTTATTGATGAAATTCATACGGTAGTCGGTA
CTGGCTCAGGCGGTTCGGGTGGTTTGGATGCGTCTAACTTACTCAAACCG
CTGCTTTCTTCAGGAAAGATTCGCTGTATTGGTTCTACCACGTATGAGGA
ATACACCAAACATTTTCGCAAAGATCAGGCGTTAGCACGGCGTTTTCAAA
AAATTGATATTGAAGAGCCTTCTGAGGAGGAAACCCTCCGAATTTTGGAA
GGGATTCGCACGCTTTACGAAGACTTTCATGCAGTGCATTACAGTGATGA
AGCATTAGCTGCTGCGGTGAGACTTTCGGTGCAATACATCCAAGGGAGAC
ATCTGCCGGATAAGGCGATTGATATTATCGACGAAGCAGGCGCGTGTGCA
AAGCTATCCCGGGGAAAGCACGGAACAGAGGGAGTGTGTTCAGTAATTGG
GGAGTCGGATATAGACGAAATTGTGGCAAAAATTGCGAAAATCCCTAAGC
AGCGGGTATCTGCAAGTGAAATAGAAAAGTTGCGTAACTTTGAGCGCAGT
ATTTCAGAAAAAATTTTTGGACAAGGCGAGGCAATTGACTTAGTCACTCG
TACGCTGAAGCGCGCGCGGGTGGGATTGCGCGTAAAGCATAAACCTATAG
CAAACTTGCTTTTTGTGGGGGCTACCGGTGTGGGAAAAACAGAGCTTGCG
CGGACGCTTGCCCAGGAACTAGGGATTGTGCTGCATCGTTTTGACATGAG
TGAGTATCAGGAAAAGCACACGGTGAGTCGGTTGATCGGCTCACCGCCCG
GTTATGTTGGGTTTGAAGAGGGGGGATTGCTCACCGACGCGGTAAGGAAA
CAACCGCATGCGGTGCTCCTTTTGGACGAAATAGAAAAAGCTCACCCGGA
CATTTTTAATGTCCTGCTCCAGGTTATGGATTACGCAACGCTCACTGACA
ACCAAGGCAGAAAAGCGGATTTTCGCAATGTTATTTTGATAATGACAAGT
AATGCGGGTGCCCGGAACATGGGTGTTTCTCTCATCGGTTTTCACAAGGG
GCAGGTGGGTACTGCAGTTATCGACGAAGCAGTAGAACGTATTTTCTCTC
CAGAATTTCGGAATCGGCTGGACGCAGTTATTCGTTTTGATGCGTTGTCC
TTGGAAACGATGGAACGCATCGCCCGCAAGGAGCTTGCCCTGGTGTGTGA
GCAACTGCAGAAAAAACACATTCGTTTTGATATTACCGATGATGCACTCG
CGTTGCTCGCTGAGCGTAGTCACTCAGGGGGAAGTGGTGCGCGTAATGTT
GCACGCTTGGTAGAGCAAGAAGTTGCAAATGTGCTTGCAGATCTTATGCT
TTTTGGAGGAGTCGCTGAGGGGGATGCGTTGCGGTGCACGGTAAAAGATC
GGCATGCTCAATGCAATTTTCTCCGCATCGAGTGCGTGCAGTCTTCGTAT
TCGGGGAGTATCCAAGACGCGCTGGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy