Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR577 IGR573 IGR576 IGR574 IGR575 IGR579 IGR578 proC, - TP0797 apbE, - TP0796 metK, - TP0794 clpA, - TP0801 metG, - TP0798 TP0799 TP0795 dac, - TP0800 TP0793 proC, - TP0797 apbE, - TP0796 metK, - TP0794 clpA, - TP0801 metG, - TP0798 TP0799 TP0795 dac, - TP0800 TP0793 Type: tandem, Name:  - 183 Type: tandem, Name:  - 180 Type: tandem, Name:  - 181 Type: tandem, Name:  - 182 proC, - TP0797 apbE, - TP0796 metK, - TP0794 clpA, - TP0801 metG, - TP0798 TP0799 TP0795 dac, - TP0800 TP0793
* Calculated from Protein Sequence

Gene ID: TP0798

DNA Molecule Name:
1  

Genbank ID:
3323103

Gene Name:
metG  

Definition:
methionyl-tRNA synthetase

Gene Start:
866503

Gene Stop:
864071

Gene Length:
2433

Molecular Weight*:
90412

pI*:
7.32

Net Charge*:
3.42

EC:
6.1.1.10  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Dardel F, Panvert M, Fayat G.
Transcription and regulation of expression of the Escherichia coli methionyl-tRNA synthetase gene.
Mol Gen Genet. 1990 Aug;223(1):121-33.
PMID: 2259334

Meinnel T, Mechulam Y, Dardel F, Schmitter JM, Hountondji C, Brunie S, Dessen P, Fayat G, Blanquet S.
Methionyl-tRNA synthetase from E. coli--a review.
Biochimie. 1990 Aug;72(8):625-32.
PMID: 2126467

Mellot P, Mechulam Y, Le Corre D, Blanquet S, Fayat G.
Identification of an amino acid region supporting specific methionyl-tRNA synthetase: tRNA recognition.
J Mol Biol. 1989 Aug;208(3):429-43.
PMID: 2477552

Comment:
Reaction:
ATP + L-METHIONINE + TRNA(MET) = AMP + PYROPHOSPHATE + L-METHIONYL-TRNA(MET).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to methionyl-tRNA
synthetase proteins. For example residues 5-728 are 41% similar to
methionyl-tRNA synthetase of Borrelia burgdorferi,(AE001160).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0143
COG name: Methionyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0143 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 63-101, 60-96, and 22-62 represent significant (98%) hits to
blocks BL00495C,E,J, Apple domain proteins.

ProDom Summary:  Protein Domain Search
Residues 18-126 are 54% similar to methionyl-tRNA synthetase of
SYMC_YEAST. Residues 137-201, 209-246, 396-479, and 652-728 also
support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0586, leucyl-tRNA
synthetase. Residues 18-159 are 29% similar to TP0586.

Pfam Summary:  Pfam Search
Residues 2 to 385 (E-value = 3.6e-13) place TP0798 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 654 to 743 (E-value = 2.4e-33) place TP0798 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
434  
461

PDB Hit:
none

Gene Protein Sequence:
MTRKLITAALPYVNNVPHLGNLIQGLSADVFARFCRMRGYHTCFVCGTDE
YGTASETRAAEQGLSPAQLCAHYHALHRDIYQWFDLSFDYFGRTTSDAHT
ELTQALFRHLDARGFISEHESAQAYCLHCARFLADRYLRGTCPHCRNAEA
RADQCEHCGVLLEPETLLNARCVSCGTAPEFRPTRHLYLNLPALEKAYRS
WFCTTNHLWTKNAVRMTEGWLRTGLQERAITRDLRWGVPVPKAGFEQKVF
YVWFDAPVGYISITKCGTEAASSQEGGGTDDGVKEKWQSWWLDQQDVELV
QFVGKDNIPFHTLFFPCMLIGSGQRWTMLTRLSATEYLNYEGGKFSKSLG
VGVFGSDAKESGIPSDLWRFYLLYHRPEKSDAHFTWHEFQERVNSELIGN
LCNLVNRTLTFVARTYGGVVPAQDGARSTRAQVMEETLALREAVRNTAKR
MTDLMEQVQLREAFREVFALSARANKALQDGAPWKTRAQDRERADALMRE
LCYVIRDVLILAHPFLPWYTQQAARFLGVQLSSCAPEGGGAVCAAKKDAD
TAQPDTVQPTLRWSDVGERKGLTQVHPPVILFRPLETETIAAYRARYAGT
ARDGAGVSVPRTAQMPTGMNKKETDAQQKKEEREMPPPSDTARLSAFFSE
RVVLKVARVLQVERHPNADMLFVETLDDGSGVERVIVSGLVPYMAADALR
GAHVLIVDNLQPRSLRGVRSCGMLLAAEYVDAQGTKAIELVQAPWALPGE
RATLASAPPVITPHGSAVIDADAFFSVPIRVVNYAVEVAGEPLMVGGRPL
VMQRVKEGTVG

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGCGAAAATTAATCACCGCCGCACTCCCCTATGTGAACAACGTTCC
ACATTTGGGAAATCTTATCCAGGGTCTTTCTGCAGACGTTTTCGCACGTT
TCTGTCGGATGCGCGGCTATCACACGTGTTTTGTATGTGGTACCGACGAA
TACGGCACGGCAAGCGAAACCCGTGCGGCAGAACAAGGTCTCAGTCCTGC
ACAATTGTGTGCGCACTACCATGCACTGCATCGCGACATCTATCAGTGGT
TTGATCTGTCCTTCGATTATTTTGGGCGCACTACAAGCGATGCGCATACT
GAGCTTACGCAAGCGTTGTTTCGTCATTTGGATGCGCGGGGTTTTATCAG
TGAACATGAAAGTGCGCAGGCGTACTGTCTGCACTGTGCACGGTTTCTTG
CTGATCGCTATTTGCGCGGTACCTGTCCCCATTGCCGTAATGCTGAGGCG
CGTGCTGACCAGTGCGAGCACTGTGGAGTGCTCCTTGAGCCGGAAACGCT
CCTGAATGCGCGCTGTGTGAGCTGTGGCACGGCGCCGGAGTTTCGCCCTA
CGCGTCATTTGTATTTAAATTTGCCTGCACTGGAAAAAGCCTACCGCTCG
TGGTTTTGCACCACGAATCATCTGTGGACTAAAAACGCGGTGCGTATGAC
TGAAGGTTGGCTACGTACGGGATTGCAGGAGCGTGCGATCACGCGCGATC
TGCGCTGGGGGGTGCCAGTTCCCAAAGCAGGATTTGAGCAGAAGGTATTT
TATGTGTGGTTCGATGCGCCAGTCGGTTACATTTCCATTACTAAGTGCGG
CACAGAGGCAGCTTCCTCGCAAGAAGGGGGGGGGACCGACGATGGCGTGA
AAGAAAAATGGCAGTCTTGGTGGCTTGATCAGCAGGATGTGGAGTTGGTC
CAGTTTGTGGGGAAGGACAATATTCCCTTTCATACGCTGTTTTTCCCCTG
CATGCTCATCGGTTCCGGGCAGCGGTGGACGATGCTTACGCGTCTTTCTG
CGACGGAGTATTTGAATTACGAAGGGGGGAAGTTTTCTAAGTCTTTAGGG
GTGGGCGTTTTTGGTTCGGATGCAAAAGAATCGGGCATTCCCTCAGATCT
GTGGCGTTTTTATCTCCTGTACCATAGACCGGAAAAAAGCGATGCGCACT
TTACCTGGCATGAGTTTCAGGAGCGTGTAAACAGTGAGTTGATTGGTAAT
CTGTGTAATCTGGTCAATCGTACGCTCACCTTTGTGGCGCGTACGTACGG
GGGCGTGGTCCCTGCGCAAGATGGAGCGCGCAGCACCCGTGCGCAGGTGA
TGGAAGAAACGCTTGCGCTCCGCGAAGCGGTGCGGAATACTGCAAAGCGC
ATGACAGATTTAATGGAGCAGGTACAGTTGCGAGAAGCGTTTAGAGAAGT
GTTTGCGCTCTCAGCGCGTGCGAATAAGGCGTTGCAGGATGGTGCACCGT
GGAAAACGCGGGCGCAGGACCGTGAACGTGCAGACGCCTTGATGCGTGAG
TTATGCTATGTGATTCGGGATGTGCTGATTTTAGCGCATCCTTTTTTGCC
GTGGTACACGCAGCAAGCGGCCCGATTTTTGGGTGTTCAGTTGTCTTCCT
GTGCACCAGAGGGGGGAGGAGCTGTGTGTGCTGCGAAGAAAGACGCGGAT
ACGGCGCAGCCGGACACAGTGCAACCGACCCTCCGATGGTCAGACGTGGG
AGAACGCAAGGGTTTAACGCAGGTGCATCCGCCGGTGATTTTATTCCGTC
CGTTGGAGACGGAAACTATTGCTGCGTATCGTGCCCGCTATGCTGGAACA
GCCAGGGATGGGGCAGGAGTGAGCGTACCGCGCACTGCACAGATGCCCAC
GGGAATGAATAAGAAAGAGACAGACGCTCAACAAAAGAAGGAGGAGCGTG
AAATGCCCCCTCCCTCAGATACTGCACGGTTATCTGCATTTTTTTCTGAG
CGCGTTGTACTGAAAGTAGCACGAGTGTTGCAGGTGGAGCGTCATCCGAA
TGCGGATATGCTTTTTGTTGAAACATTAGATGATGGCTCTGGCGTTGAGC
GCGTTATTGTTTCTGGTCTTGTGCCTTATATGGCTGCAGATGCGTTGCGT
GGTGCGCACGTGCTTATTGTGGATAATCTGCAGCCGCGCTCACTGCGTGG
GGTACGGTCTTGCGGCATGCTGTTGGCCGCAGAGTATGTAGATGCGCAGG
GCACAAAGGCAATTGAATTGGTGCAGGCGCCATGGGCTCTGCCCGGTGAA
CGCGCAACACTTGCGAGTGCGCCGCCGGTCATTACACCGCACGGGTCTGC
CGTTATCGATGCGGACGCTTTTTTTTCTGTGCCTATTCGTGTGGTAAATT
ATGCAGTAGAAGTTGCAGGTGAGCCGCTCATGGTTGGAGGAAGGCCACTG
GTAATGCAGCGAGTGAAAGAGGGAACTGTCGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy