Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR573 IGR576 IGR574 IGR575 IGR572 IGR571 TP0791 proC, - TP0797 apbE, - TP0796 metK, - TP0794 metG, - TP0798 TP0790 TP0795 flaB2, - TP0792 TP0793 TP0791 proC, - TP0797 apbE, - TP0796 metK, - TP0794 metG, - TP0798 TP0790 TP0795 flaB2, - TP0792 TP0793 Type: tandem, Name:  - 183 Type: tandem, Name:  - 180 Type: tandem, Name:  - 181 Type: tandem, Name:  - 182 TP0791 proC, - TP0797 apbE, - TP0796 metK, - TP0794 metG, - TP0798 TP0790 TP0795 flaB2, - TP0792 TP0793
* Calculated from Protein Sequence

Gene ID: TP0794

DNA Molecule Name:
1  

Genbank ID:
3323100

Gene Name:
metK  

Definition:
S-adenosylmethionine synthetase

Gene Start:
861877

Gene Stop:
860690

Gene Length:
1188

Molecular Weight*:
42979

pI*:
6.15

Net Charge*:
-7.08

EC:
2.5.1.6  

Functional Class:
Amino acid biosynthesis; methionine, selenomethionine  
Central intermediary metabolism; Other  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein catalyses the formation of S-adenosylmethionine from
methionine and ATP.

Reaction:
ATP + L-METHIONINE + H(2)O =
ORTHOPHOSPHATE + PYROPHOSPHATE + S-ADENOSYL-L-METHIONINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to S-adenosylmethionine
synthetase proteins. For example residues 5-376 are 56% similar to
METK_ECOLI, S-adenosylmethionine synthetase of E. coli,(AE000377).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0192
COG name: S-adenosylmethionine synthetase
Functional Class:  H
The phylogenetic pattern of COG0192 is ----Yqvcebrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 21-75, 110-146, 150-199, 230-279, 280-323, and 352-369
represent significant (100%) hits to blocks BL00376A,B,C,D,E,F,
S-adenosylmethionine synthetase proteins.

ProDom Summary:  Protein Domain Search
Residues 3-356 are 53% similar to S-adenosylmethionine synthetase of
METK_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 101 (E-value = 4.2e-47) place TP0794 in the S-AdoMet_synt_N family which is described as S-adenosylmethionine synthetase, N-terminal domain (PF00438)
Residues 116 to 235 (E-value = 1.1e-53) place TP0794 in the S-AdoMet_synt_M family which is described as S-adenosylmethionine synthetase, central domain (PF02772)
Residues 237 to 374 (E-value = 6.3e-79) place TP0794 in the S-AdoMet_synt_C family which is described as S-adenosylmethionine synthetase, C-terminal domain (PF02773)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
197  
293

PDB Hit:
gi|1421282|pdb|1XRA| Mol_id: 1; Molecule: S-Adenosylmethionine Synthetase; Chain: Null; Synonym: Mat, Atp:l-Methionine S-Adenosyltransferase; Ec: 2.5.1.6; Biological_unit: Homotetramer

Gene Protein Sequence:
METFFTSESVSEGHPDKLCDQISDAVLDACLSQDPHSCVACETFASTSLI
LIGGEISTRAHINLTQIARDVAADIGYVSADVGLDAASMAVLDMTHHQSP
DIAQGVHGAGLKEFAGSQGAGDQGIMFGFACRETPEFMPAPLMCAHAVVR
YAATLRHERRVPWLRPDAKSQVTVQYEGHRPVRISAVVFSQQHDPSPSYE
TIRETLIEEIVRPALAPTGLLDENTRFFINPTGRFVIGGPFGDTGLTGRK
IIVDTYGGMGRHGGGSFSGKDASKVDRSAAYMARYIAKNIVAADLAERCE
VQLAYAIGVPYPVSLRIETFGTARASESHITHAVKEIFDLTPAGIVRTLD
LCAPRYRSTAVYGHFGREQFPWERTDCVCDLQRAVRPFALSGQIKE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGACGTTTTTTACCTCAGAGTCTGTGAGTGAGGGTCATCCTGATAA
GCTGTGCGACCAGATTTCTGACGCTGTTCTTGATGCCTGTCTTTCGCAAG
ATCCTCACAGTTGTGTTGCGTGCGAAACTTTTGCCTCCACGTCCCTTATC
CTGATTGGAGGTGAAATTAGCACGCGGGCGCATATTAATCTTACCCAAAT
TGCGCGTGATGTTGCCGCTGACATTGGATATGTAAGCGCTGATGTCGGTC
TTGATGCAGCGTCCATGGCTGTTCTTGATATGACTCATCATCAGTCGCCT
GATATTGCGCAGGGGGTGCACGGTGCAGGACTGAAGGAGTTTGCAGGATC
GCAGGGGGCAGGGGATCAGGGGATTATGTTTGGTTTTGCGTGCCGCGAGA
CGCCGGAGTTTATGCCCGCCCCCCTCATGTGCGCGCACGCGGTTGTGCGC
TATGCTGCCACGCTTCGTCATGAACGCCGTGTGCCGTGGCTGCGTCCTGA
TGCAAAAAGTCAGGTTACCGTACAATACGAGGGACATCGACCGGTACGTA
TCAGTGCGGTTGTGTTTTCTCAGCAGCATGATCCGTCACCTTCATACGAA
ACCATTAGAGAAACGCTCATAGAGGAGATAGTGCGTCCGGCGCTTGCACC
TACAGGTCTGTTAGATGAAAACACGCGTTTTTTTATCAATCCAACCGGTC
GTTTTGTCATTGGCGGTCCCTTTGGGGACACTGGTTTGACCGGGAGAAAG
ATCATCGTAGACACGTATGGGGGAATGGGCCGCCATGGAGGAGGCTCCTT
TTCAGGTAAGGATGCATCTAAGGTAGATCGTTCTGCAGCGTATATGGCGC
GTTATATTGCAAAAAATATTGTGGCAGCCGACCTTGCTGAGCGCTGTGAG
GTGCAGCTTGCATACGCAATCGGCGTACCATATCCGGTTTCGCTGCGGAT
AGAAACATTTGGAACGGCGCGCGCATCTGAGTCACACATCACACACGCGG
TGAAAGAGATTTTTGATTTAACCCCAGCGGGTATCGTGCGCACGTTGGAC
CTGTGTGCGCCTCGGTACCGCTCGACTGCAGTGTATGGTCACTTTGGGCG
CGAACAGTTTCCTTGGGAACGCACAGACTGCGTGTGCGACTTACAGCGTG
CGGTGCGCCCGTTCGCGCTCTCTGGCCAGATAAAAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy