Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR564 IGR562 IGR563 IGR561 IGR559 IGR560 IGR558 IGR557 IGR566 IGR565 TP0777 TP0782 TP0781 dedA, - TP0779 TP0776 mazG, - TP0778 TP0783 nadE, - TP0780 TP0784 nth, - TP0775 mgtC, - TP0774 TP0785 TP0786 TP0777 TP0782 TP0781 dedA, - TP0779 TP0776 mazG, - TP0778 TP0783 nadE, - TP0780 TP0784 nth, - TP0775 mgtC, - TP0774 TP0785 TP0786 Type: tandem, Name:  - 269 Type: tandem, Name:  - 176 Type: tandem, Name:  - 177 Type: tandem, Name:  - 178 Type: tandem, Name:  - 270 TP0781 dedA, - TP0779 TP0776 mazG, - TP0778 TP0783 nadE, - TP0780 TP0777 TP0782 TP0784 nth, - TP0775 mgtC, - TP0774 TP0786 TP0785
* Calculated from Protein Sequence

Gene ID: TP0780

DNA Molecule Name:
1  

Genbank ID:
3323089

Gene Name:
nadE  

Definition:
conserved hypothetical protein/ possible NH(3)-dependent NAD(+) synthetase

Gene Start:
848364

Gene Stop:
846328

Gene Length:
2037

Molecular Weight*:
72034

pI*:
6.87

Net Charge*:
-1.45

EC:
6.3.5.1  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Bellinzoni M, De Rossi E, Branzoni M, Milano A, Peverali FA, Rizzi M, Riccardi G.
Heterologous expression, purification, and enzymatic activity of Mycobacterium tuberculosis NAD(+) synthetase.
Protein Expr Purif. 2002 Aug;25(3):547-57.
PMID: 12182838

Schneider BL, Reitzer LJ.
Salmonella typhimurium nit is nadE: defective nitrogen utilization and ammonia-dependent NAD synthetase.
J Bacteriol. 1998 Sep;180(17):4739-41.
PMID: 9721319

Antelmann H, Schmid R, Hecker M.
The NAD synthetase NadE (OutB) of Bacillus subtilis is a sigma B-dependent general stress protein.
FEMS Microbiol Lett. 1997 Aug;153(2):405-9.
PMID: 9271869

Willison JC, Tissot G.
The Escherichia coli efg gene and the Rhodobacter capsulatus adgA gene code for NH3-dependent NAD synthetase.
J Bacteriol. 1994 Jun;176(11):3400-2.
PMID: 8195100

Comment:
This protein is involved in the de novo biosynthesis of NAD.

Reaction:
ATP + DEAMIDO-NAD(+) + NH(3) + H(2)O = AMP + PYROPHOSPHATE + NAD(+).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the C-terminal region had significant hits to
NH(3)-dependent NAD(+) synthetases. However only one protein had
a significant hit across the entire protein. Residues 26-674 are
27% similar to a hypothetical protein of Mycobacterium tuberculosis,
(Z81451). Residues 338-674 are 28% similar to NADE_RHOCA, NH(3)-
dependent NAD(+) synthetase of Rhodobacter capsulatus,(X59399).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0171
COG name: NAD synthase
Functional Class:? H
The phylogenetic pattern of COG0171 is amtkyqVcebr-ujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 375-389 represent significant (98%) hits to BL00564A,
Argininosuccinate synthase proteins.

ProDom Summary:  Protein Domain Search
Residues 461-518 are 39% similar to NH(3)-dependent NAD(+) synthetase
of NADE_RHOCA, however the score is low for this hit.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 409 to 645 (E-value = 4.3e-104) place TP0780 in the NAD_synthase family which is described as NAD synthase (PF02540)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
38  
365

PDB Hit:
none

Gene Protein Sequence:
MRGCGVDRTGGYVRLALAAPAVRVADCAYNTQRMIQTVRRAASCGVDILL
FPRLSLTGCSCASLFAQDTLLSAVCTHVSALCAGTADCQLLALVSVPCFL
RTQVRVCTALVARGRVLALVVQDTLAACGAQKMQVPCEVLYGGAPVPVYD
VQTCFESAEGLFSFCVGAMDGSVPATLVLQAYGTPSTAQTPDIFAAHAAA
YSAQHQCAYAYVNAGWGESSADAVYGAESGIFECGQCVVQDSLQEMRERG
ERPAHAVRGLHVSADVDVSLVHFRRRARSGHTTLGASAPCVTLPAGIFAA
SKAHATLRRPRVPCPFFPPAFQKSQDAVPPLTGAVCLAVSAPSDTQDGFL
QRTIDLAAQGVALRLEHMGCRRLVVGVSGGVDSACALLICARALDFLSIA
RTQLYALTLPGFGTTSGTKGAAQEFARALGCTVQEISISAAVTHHLHDIG
HTMQQCDGTYENAQARERTQILLDRANQLDALMIGTGDASEGALGWETFG
GDHLSLYAVNASLPKTVVRALISYAGRVPERFVCETDSPYAPRGAAFSRV
CAAIVAQPVSPELIPPCDDRIVQCTEEMLGPYELHDFFLYHITVNGFGPR
KLFRVAAHAFGXAYSCAQLCAALRVFFTRLFSQQFKRSCVPDGPGLTEVN
LSPRVGFYFPSDTSGALWRAELEQLACGE

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGGGGGTGTGGTGTGGATAGGACGGGTGGATACGTGCGGCTTGCGCT
TGCAGCCCCTGCGGTGCGTGTTGCGGACTGTGCATACAATACCCAGCGTA
TGATTCAGACGGTGCGTCGTGCAGCTTCATGCGGTGTGGACATACTATTG
TTTCCCCGTCTTTCGCTTACAGGGTGTAGCTGTGCGTCTCTTTTTGCTCA
GGATACGCTGCTTTCGGCAGTCTGCACGCACGTATCTGCACTGTGTGCTG
GCACTGCTGATTGTCAGCTGTTAGCGCTTGTGAGTGTGCCCTGTTTTTTG
CGCACTCAGGTGCGCGTGTGTACTGCGCTTGTCGCACGAGGTCGTGTTCT
AGCACTGGTTGTGCAGGATACCCTGGCGGCGTGTGGCGCGCAAAAAATGC
AAGTGCCCTGTGAGGTCCTGTACGGTGGTGCACCGGTGCCGGTGTACGAT
GTGCAGACGTGTTTTGAAAGTGCAGAGGGTCTTTTCTCTTTTTGTGTTGG
TGCTATGGATGGATCGGTACCTGCCACGCTGGTGTTGCAGGCCTACGGTA
CGCCAAGTACGGCGCAGACACCGGATATTTTTGCTGCGCACGCTGCGGCA
TACAGTGCACAGCACCAATGTGCGTATGCGTACGTAAATGCGGGGTGGGG
GGAGTCTAGTGCTGATGCGGTGTATGGCGCGGAAAGTGGTATTTTTGAGT
GTGGGCAGTGTGTGGTCCAAGACTCATTGCAGGAGATGCGAGAACGGGGG
GAGCGTCCGGCGCACGCGGTGCGTGGACTGCATGTTAGTGCGGACGTAGA
TGTGTCTTTGGTACACTTTCGTCGTCGTGCGCGTAGCGGACATACCACTC
TGGGTGCATCGGCTCCCTGCGTCACGCTTCCTGCAGGCATATTTGCAGCG
TCAAAGGCGCACGCCACGCTGCGGCGTCCTCGCGTACCCTGTCCTTTTTT
TCCGCCTGCTTTTCAAAAATCGCAGGATGCGGTGCCCCCGCTCACGGGTG
CCGTGTGCCTCGCTGTTTCTGCACCGTCAGACACGCAGGACGGTTTTTTG
CAAAGAACGATAGACTTAGCCGCGCAGGGCGTGGCACTCCGTCTTGAACA
CATGGGCTGTAGGCGCCTGGTGGTGGGTGTTTCAGGAGGTGTTGATTCGG
CGTGTGCATTGCTAATATGCGCGCGCGCGTTAGATTTTCTCTCGATTGCG
CGTACACAACTTTATGCGCTAACGCTTCCTGGCTTTGGTACTACGTCAGG
AACGAAAGGTGCGGCGCAGGAGTTTGCGCGTGCGCTCGGTTGCACTGTGC
AAGAAATTTCTATTAGCGCGGCAGTGACGCATCATCTCCATGATATTGGG
CATACGATGCAGCAGTGTGACGGTACGTATGAGAATGCACAGGCGCGCGA
ACGGACGCAGATTTTGTTAGATCGTGCTAACCAGCTTGATGCGCTCATGA
TTGGTACGGGAGATGCGTCAGAAGGTGCGCTTGGTTGGGAAACCTTTGGG
GGCGATCACCTTTCGCTGTACGCAGTGAACGCATCTTTGCCCAAAACCGT
GGTGCGAGCCTTGATTTCCTATGCTGGGCGTGTACCTGAGCGTTTTGTGT
GTGAAACTGATTCTCCCTATGCACCGCGCGGTGCTGCCTTTTCTCGCGTT
TGTGCAGCTATAGTTGCACAGCCGGTGAGTCCTGAGCTCATACCTCCTTG
TGATGATCGTATTGTGCAGTGTACCGAGGAGATGCTCGGTCCTTATGAAT
TGCATGATTTTTTTCTGTATCACATAACGGTGAACGGTTTTGGTCCTCGA
AAACTTTTTCGTGTGGCCGCGCATGCGTTTGGAAMTGCGTATTCTTGCGC
GCAGCTATGTGCAGCGCTGCGCGTTTTTTTTACCCGCTTGTTTTCACAGC
AGTTCAAGCGTTCTTGTGTGCCTGATGGGCCCGGTCTTACGGAAGTGAAC
CTTTCCCCTCGTGTGGGTTTTTATTTTCCCAGCGACACTTCCGGTGCGCT
ATGGCGCGCAGAGCTTGAGCAGCTGGCTTGTGGGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy