Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 tRNA-Leu-4 IGR554 IGR553 IGR555 IGR559 IGR560 IGR558 IGR557 IGR556 TP0777 dedA, - TP0779 TP0776 mazG, - TP0778 htrA, - TP0773 TP0771 nth, - TP0775 mgtC, - TP0774 TP0772 deaD, - TP0770 TP0777 dedA, - TP0779 TP0776 mazG, - TP0778 htrA, - TP0773 TP0771 nth, - TP0775 mgtC, - TP0774 TP0772 deaD, - TP0770 Type: tandem, Name:  - 175 dedA, - TP0779 TP0776 mazG, - TP0778 htrA, - TP0773 TP0771 TP0777 nth, - TP0775 mgtC, - TP0774 TP0772 deaD, - TP0770
* Calculated from Protein Sequence

Gene ID: TP0773

DNA Molecule Name:
1  

Genbank ID:
3323080

Gene Name:
htrA  

Definition:
periplasmic serine protease DO

Gene Start:
841793

Gene Stop:
840600

Gene Length:
1194

Molecular Weight*:
42174

pI*:
10.27

Net Charge*:
7.93

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is a serine protease that is required at high temperature.
It is involved in the degradation of damaged proteins. It can degrade
IciA, Ada, casein and globin.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to serine proteases.
For example residues 103-392 are 39% similar to HTOA_HAEIN, periplasmic
serine protease Do and heat shock protein of Haemophilus influenzae,
(U32805).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0265
COG name: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
Functional Class:  O
The phylogenetic pattern of COG0265 is --t-yqvCEBRHuj--oLinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 114-126, 135-155, 54-74, 178-202, 52-76, 214-231, 236-253,
284-301, and 341-353 represent siginifcant (100%) hits to blocks
PR00834A,B,C,D,E,F, HTRA/DEGQ PROTEASE FAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 112-282 are 48% similar to serine protease DO of HTOA_HAEIN.
Residues 172-258, 290-326, and 345-360 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0841 and TP0546 both of
which are periplasmic serine protease DO. Residues 103-398 are 34%
similar to TP0841 and residues 105-383 are 35% similar to TP0546.

Pfam Summary:  Pfam Search
Residues 91 to 270 (E-value = 5.8e-23) place TP0773 in the Trypsin family which is described as Trypsin (PF00089)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
32
non-globular  
266  
351

PDB Hit:
gi|230925|pdb|3SGB|E Streptomyces griseus

Gene Protein Sequence:
MRNKVRVLAVVAALAAACAVGFFLGRWFDFSARSSVLEAADSLSVSSSEA
ASFSTVVAEGDPYTVDERQNIAVYRSANEAVVNITTEMVGVNWFLEPVPL
EGGSGSGAIIDARGYVLTNTHVIEGASKIYLSLHDGSQYKATVVGVDREN
DLAVLKFVSPPGARLTVIRFGSSRNLDVGQKVLAIGNPFGLARTLTVGVV
SALARPIQNKGSIIRNMIQTDAAINPGNSGGPLLDTQGRMIGINTVIYST
SGSSSGVGFAVPVDTAKRIVSELIRYGRVRRGKIDAELVQVNASIAHYAQ
LTVGKGLLVSQVKRGSPAAQAGLRGGTTAVRYGLGRRAAVIYLGGDVITA
IDNQPVANLSDYYSVLEDKKPDDEVRVTVLRGRRQHVVAVRLTERSDE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCAACAAGGTGCGAGTTCTTGCGGTGGTCGCAGCGCTTGCGGCTGC
GTGCGCGGTGGGCTTCTTTCTAGGAAGGTGGTTCGACTTCTCTGCTAGGT
CCTCGGTGCTCGAAGCAGCTGATTCCCTCTCCGTTTCTTCTTCGGAAGCG
GCCAGCTTTTCCACGGTTGTTGCAGAGGGGGACCCGTACACCGTCGACGA
GCGGCAGAACATCGCCGTTTACCGCAGTGCCAACGAGGCCGTTGTCAACA
TTACCACTGAGATGGTAGGGGTTAATTGGTTCTTAGAGCCCGTGCCTCTC
GAAGGTGGCTCTGGGTCTGGCGCTATCATTGACGCCCGCGGGTACGTGCT
CACCAATACGCACGTCATCGAGGGTGCGTCTAAAATTTATCTCTCGCTAC
ACGACGGCAGCCAGTACAAGGCAACTGTCGTGGGTGTAGACAGGGAGAAT
GATCTTGCGGTGCTTAAGTTTGTTTCTCCTCCTGGAGCACGCTTGACAGT
TATCCGCTTCGGTTCTTCGCGCAACTTGGATGTCGGACAAAAGGTGCTTG
CCATCGGGAATCCCTTTGGACTAGCGCGTACTCTTACCGTCGGGGTTGTT
TCTGCTCTCGCGCGTCCCATTCAAAATAAGGGCAGTATCATCAGAAATAT
GATTCAGACGGACGCGGCGATCAATCCTGGGAATTCTGGTGGTCCGCTTC
TGGATACCCAGGGGCGCATGATAGGCATTAATACCGTTATTTACTCTACA
TCTGGAAGTTCTTCTGGTGTTGGCTTTGCGGTGCCAGTAGATACCGCAAA
GCGCATAGTGTCCGAGCTAATTCGCTACGGCCGTGTGCGTCGCGGCAAAA
TCGATGCCGAACTCGTGCAAGTCAACGCATCTATTGCTCACTACGCGCAG
CTTACAGTAGGCAAGGGATTGCTGGTATCACAGGTCAAGCGGGGAAGCCC
CGCTGCACAGGCAGGACTGCGCGGTGGCACGACGGCCGTACGCTATGGAC
TGGGACGGAGAGCAGCGGTTATCTACTTGGGGGGAGACGTCATTACCGCC
ATCGACAACCAGCCTGTAGCGAATCTGAGCGATTATTACTCGGTGTTGGA
GGATAAGAAGCCTGACGACGAAGTTCGCGTTACAGTACTCCGCGGCAGAC
GGCAGCATGTGGTAGCCGTGCGGCTCACAGAACGCTCAGATGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy