Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR547 IGR548 IGR551 IGR550 IGR549 TP0763 ftsH, - TP0765 TP0761 TP0766 tmpA, - TP0768 TP0764 TP0762 fusA, - TP0767 TP0763 ftsH, - TP0765 TP0761 TP0766 tmpA, - TP0768 TP0764 TP0762 fusA, - TP0767 Type: tandem, Name:  - 173 Type: tandem, Name:  - 174 TP0763 ftsH, - TP0765 TP0761 TP0766 tmpA, - TP0768 TP0764 TP0762 fusA, - TP0767
* Calculated from Protein Sequence

Gene ID: TP0765

DNA Molecule Name:
1  

Genbank ID:
3323067

Gene Name:
ftsH  

Definition:
cell division protein FtsH

Gene Start:
830201

Gene Stop:
828375

Gene Length:
1827

Molecular Weight*:
67535

pI*:
6.11

Net Charge*:
-5.65

EC:
3.4.24.-  

Functional Class:
Cellular processes; Cell division  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Fischer B, Rummel G, Aldridge P, Jenal U.
The FtsH protease is involved in development, stress response and heat shock control in Caulobacter crescentus.
Mol Microbiol. 2002 Apr;44(2):461-78.
PMID: 11972783

Inagawa T, Kato J, Niki H, Karata K, Ogura T.
Defective plasmid partition in ftsH mutants of Escherichia coli.
Mol Genet Genomics. 2001 Jul;265(5):755-62.
PMID: 11523792

Jayasekera MM, Foltin SK, Olson ER, Holler TP.
Escherichia coli requires the protease activity of FtsH for growth.
Arch Biochem Biophys. 2000 Aug;380(1):103-7.
PMID: 10900138

Wehrl W, Niederweis M, Schumann W.
The FtsH protein accumulates at the septum of Bacillus subtilis during cell division and sporulation.
J Bacteriol. 2000 Jul;182(13):3870-3.
PMID: 10851010

Comment:
This protein seems to act as an ATP-dependent zinc metallopeptidase.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to cell division
protein FtsH. For example residues 63-599 are 46% similar to FtsH
protein of Helicobacter pylori,(U97567).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0465
COG name: ATP-dependent Zn proteases
Functional Class:? O
The phylogenetic pattern of COG0465 is ----YqvCeBrHUJgpoLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 140-155, 174-195, 213-249, 266-311, 343-363, and 204-224
represent significant (100%) hits to blocks BL00674A,B,C,D,E,
AAA-protein family proteins. Residues 176-191 and 588-602 represent
significant (99%) hits to blocks PR00819B,C, CBXX/CFQX SUPERFAMILY
SIGNATURE. Residues 431-446 represent a significant (96%) hit to
block PR00655E, AUXIN BINDING PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 424-563 are 41% similar to cell division protein of FTSH_HELPY.
Residues 86-296, 135-311, 212-244 and 284-346 also support matches
to cell division proteins.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0330, cell division
protein (ftsH), TP0524, ATP-dependent protease LA, and TP0508,
ATP-dependent Clp protease subunit X. Residues 173-378 are 27%
similar to TP0330, residues 142-277 are 32% similar to TP0524,
and residues 177-270 are 31% similar to TP0508.

Pfam Summary:  Pfam Search
Residues 2 to 150 (E-value = 1e-37) place TP0765 in the FtsH_ext family which is described as FtsH Extracellular (PF06480)
Residues 176 to 362 (E-value = 1.3e-91) place TP0765 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 368 to 577 (E-value = 1.5e-116) place TP0765 in the Peptidase_M41 family which is described as Peptidase family M41 (PF01434)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
366  
397
coil-coil  
539  
597

PDB Hit:
none

Gene Protein Sequence:
MRIIPFSEFKDRIASGEIVKVVVGSPYFVGYTSARPAPSARGFSLLSERE
APTYHAIGVLSDSFLSMLDERQVVYSIKPRERNYLIETFQYLFPLLILFF
VWRFFFKRMASNVSGLGSSIFSAGHARSAAVEEGKVTTRFADVAGVDEAK
EELMEVVDFLKFPKKYTEIGGKIPRGVLLVGPPGTGKTLLARAVAGEASV
PFFRISGSDFIEMFVGIGASRVRDLFKQAREKAPGIIFIDELDAIGKSRL
NAIHSNDEREQTLNQLLVEMDGFDNTTGLILLAATNRPDVLDPALLRPGR
FDRQVCVDRPDLKGREAILRIHAQNVKLAPEVDLKAVARITGGYSGADLA
NVVNEAALLAVRSGRAQVIETDLDEAVEKTMIGLQKKSRVIREEERRIIA
YHETGHALAGTFTKGADKVHKITIIPRGTSALGYTFHIPEDDRHIVTEQQ
LLAEVDVLLSGRAAEFVAFGEVSTGAGNDISRATDIVRKMITDYGMSEKF
QNVALTRRGTGYLAEPQLAREYSECTQQYVDEEVARVLAERYRAVVALLT
EKKELLEYIATRLLERETIERDEFEEVIRCEHDLEGLKKRLSQQQEGASA
PAQGQSPPS

Gene Nucleotide Sequence:  Sequence Viewer
TTGCGCATCATCCCGTTCTCGGAATTTAAAGATCGCATTGCAAGTGGGGA
AATCGTAAAGGTTGTTGTCGGTTCCCCTTACTTTGTCGGGTACACTTCCG
CGCGCCCTGCGCCTTCTGCGCGGGGTTTCTCGTTGCTCTCTGAGCGGGAG
GCTCCTACCTATCATGCCATCGGTGTCCTCTCCGATTCCTTTTTGAGCAT
GCTCGATGAGCGGCAGGTGGTCTACAGTATTAAGCCGCGCGAGCGCAATT
ACCTCATAGAGACATTTCAATATCTCTTTCCGCTGCTCATCCTCTTTTTT
GTCTGGCGCTTTTTCTTTAAGCGGATGGCCTCAAATGTAAGCGGGCTGGG
GAGCAGTATTTTCTCAGCCGGACACGCGCGCTCTGCGGCGGTGGAAGAAG
GAAAGGTCACCACACGCTTTGCAGACGTTGCAGGGGTGGATGAGGCAAAA
GAAGAGCTGATGGAAGTAGTTGATTTTCTCAAGTTCCCTAAAAAGTATAC
TGAAATCGGGGGGAAAATTCCCCGCGGGGTGCTGTTGGTCGGTCCCCCAG
GGACGGGTAAGACGTTGCTTGCACGCGCAGTGGCAGGTGAGGCGTCAGTG
CCCTTTTTTCGCATCAGTGGCTCAGACTTCATCGAAATGTTTGTGGGGAT
TGGCGCCTCGCGTGTGCGCGATTTATTCAAACAAGCGCGGGAGAAGGCGC
CAGGGATTATTTTTATCGATGAGCTTGACGCAATTGGAAAAAGCCGCCTG
AACGCTATCCATTCCAACGATGAGCGGGAACAAACGCTTAACCAGCTTCT
GGTAGAAATGGATGGGTTTGATAACACCACCGGTCTCATTTTGCTTGCTG
CTACCAATCGCCCCGATGTGTTAGATCCTGCGCTCCTACGCCCCGGTCGT
TTTGACCGACAGGTTTGCGTAGATCGGCCCGATCTTAAGGGAAGAGAGGC
AATTCTGCGTATTCATGCGCAGAACGTGAAGTTAGCGCCAGAAGTGGATT
TGAAGGCAGTGGCGCGCATCACCGGTGGGTATTCAGGTGCTGATTTGGCA
AACGTGGTGAACGAGGCAGCGTTGCTCGCGGTACGGTCTGGGCGTGCGCA
GGTGATTGAAACGGATTTGGACGAAGCGGTCGAAAAGACAATGATAGGAT
TGCAGAAAAAAAGTCGGGTAATTCGAGAAGAAGAGCGCCGGATTATTGCG
TATCACGAGACAGGACATGCCCTTGCAGGTACCTTCACGAAGGGTGCAGA
CAAGGTGCACAAAATTACAATTATTCCCCGGGGCACCTCTGCGCTTGGAT
ATACTTTTCACATTCCTGAAGACGATCGGCATATTGTTACGGAGCAGCAG
TTGTTGGCAGAAGTAGATGTGCTGCTTTCAGGACGCGCAGCGGAATTTGT
AGCCTTTGGGGAAGTTTCAACTGGTGCAGGGAACGATATTTCTCGCGCAA
CAGACATTGTCCGCAAGATGATTACAGATTATGGGATGAGCGAAAAGTTT
CAAAACGTTGCACTTACTCGCCGCGGAACCGGGTATCTCGCGGAGCCGCA
GTTAGCGCGCGAGTATTCGGAGTGCACACAGCAGTACGTTGATGAGGAAG
TGGCGCGCGTTCTAGCTGAGCGCTACCGCGCGGTGGTAGCACTCTTGACG
GAGAAAAAAGAGCTCCTTGAGTACATCGCAACGCGCCTTTTGGAGCGAGA
AACCATCGAGCGCGACGAGTTTGAGGAAGTTATTCGCTGCGAACACGACC
TAGAGGGGCTAAAAAAGCGTCTAAGCCAGCAGCAGGAAGGGGCATCTGCC
CCTGCGCAGGGTCAGTCGCCACCTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy