Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR544 IGR547 IGR545 IGR542 IGR548 IGR541 IGR546 IGR540 IGR543 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 TP0763 fmt, - TP0756 TP0752 TP0754 TP0762 pbp, - TP0760 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 TP0763 fmt, - TP0756 TP0752 TP0754 TP0762 pbp, - TP0760 Type: tandem, Name:  - 171 Type: tandem, Name:  - 172 Type: tandem, Name:  - 173 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 TP0763 fmt, - TP0756 TP0752 TP0754 TP0762 pbp, - TP0760 TP0759 TP0761 TP0759 TP0761
* Calculated from Protein Sequence

Gene ID: TP0757

DNA Molecule Name:
1  

Genbank ID:
3323063

Gene Name:
def  

Definition:
polypeptide deformylase

Gene Start:
821781

Gene Stop:
821296

Gene Length:
486

Molecular Weight*:
18307

pI*:
6.36

Net Charge*:
-1.94

EC:
3.5.1.31  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Ramesh V, Köhrer C, RajBhandary UL.
Expression of Escherichia coli methionyl-tRNA formyltransferase in Saccharomyces cerevisiae leads to formylation of the cytoplasmic initiator tRNA and possibly to initiation of protein synthesis with formylmethionine.
Mol Cell Biol. 2002 Aug;22(15):5434-42.
PMID: 12101237

Comment:
This protein removes the formyl group from the N-terminal Met of
newly synthesized proteins.

Reaction:
N-FORMYL-L-METHIONINE + H(2)O = FORMATE + L-METHIONINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to polypeptide deformylases.
For example residues 1-145 are polypeptide deformylase of Borrelia
burgdorferi,(AE001119).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0242
COG name: N-formylmethionyl-tRNA deformylase
Functional Class:? J
The phylogenetic pattern of COG0242 is -----qvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-111 are 40% similar to polypeptide deformylase of DEF_SYNY3.
Residues 112-140 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 148 (E-value = 5.7e-49) place TP0757 in the Pep_deformylase family which is described as Polypeptide deformylase (PF01327)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
112  
162

PDB Hit:
gi|2098360|pdb|1DEF| Peptide Deformylase Catalytic Core (Residues 1 - 147), Nmr, 9 Structures Hydrolase, Zinc Metalloprotease Mol_id: 1; Molecule: Peptide Deformylase; Chain: Null; Fragment: Active Catalytic Core, Residues 1 - 147; Ec: 3.5.1.31; Engin...

Gene Protein Sequence:
MELKFLGEPCLTTVSEPVSEVDEQLRAFISGMFRVMRGAGGVGLAAPQVG
RTVRVFVVDVEHHVRAFINPQITAASEEQSSYEEGCLSIPHIYERVLRPR
RVSVQYLDENGKRCAVDADGILARVIQHEYDHLDGILFLDRIDEKRRDDA
LRRYAALRGTIR

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAGCTTAAGTTTTTAGGTGAGCCGTGCCTGACAACGGTTTCCGAGCC
GGTTTCGGAGGTGGACGAGCAGCTGCGCGCGTTCATCTCGGGTATGTTTC
GTGTGATGCGTGGGGCAGGCGGTGTGGGGCTTGCGGCGCCGCAGGTAGGG
CGTACCGTCCGCGTGTTTGTAGTAGATGTTGAGCACCACGTCCGCGCTTT
TATCAATCCCCAGATCACTGCCGCGTCTGAAGAGCAATCTTCCTACGAGG
AAGGCTGTTTGAGCATTCCTCACATTTATGAAAGGGTGTTGCGTCCGCGT
CGGGTGAGTGTGCAGTACCTCGACGAGAATGGTAAACGTTGTGCCGTTGA
TGCAGATGGTATTCTGGCAAGAGTGATCCAGCACGAGTACGATCATCTTG
ACGGTATTCTTTTTTTGGATCGCATTGACGAAAAGCGGAGGGATGATGCC
CTTCGTCGGTATGCGGCGCTGCGCGGGACGATTCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy