Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR544 IGR539 IGR545 IGR542 IGR541 IGR546 IGR540 IGR543 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 fmt, - TP0756 TP0752 TP0754 cfpA, - TP0748 TP0750 TP0751 pbp, - TP0760 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 fmt, - TP0756 TP0752 TP0754 cfpA, - TP0748 TP0750 TP0751 pbp, - TP0760 Type: tandem, Name:  - 171 Type: tandem, Name:  - 172 Type: tandem, Name:  - 268 rpsU, - TP0758 TP0753 def, - TP0757 ptsBC,ptsA, - TP0755 fmt, - TP0756 TP0752 TP0754 TP0749 cfpA, - TP0748 TP0749 TP0750 TP0751 pbp, - TP0760 TP0759 TP0761 TP0759 TP0761
* Calculated from Protein Sequence

Gene ID: TP0755

DNA Molecule Name:
1  

Genbank ID:
3323061

Gene Name:
ptsBC  ptsA  

Definition:
PTS system nitrogen regulatory IIA component/ PTS system nitrogen regulatory BC component

Gene Start:
820130

Gene Stop:
819591

Gene Length:
540

Molecular Weight*:
20413

pI*:
7.87

Net Charge*:
2.25

EC:
2.7.1.69  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Carbohydrate metabolism; Galactose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Membrane transport; Phosphotransferase system
Nucleotide metabolism; Aminosugars metabolism

Secondary Evidence:
Michiels J, Van Soom T, D'hooghe I, Dombrecht B, Benhassine T, de Wilde P, Vanderleyden J.
The Rhizobium etli rpoN locus: DNA sequence analysis and phenotypical characterization of rpoN, ptsN, and ptsA mutants.
J Bacteriol. 1998 Apr;180(7):1729-40.
PMID: 9537369

Powell BS, Court DL, Inada T, Nakamura Y, Michotey V, Cui X, Reizer A, Saier MH, Reizer J.
Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant.
J Biol Chem. 1995 Mar;270(9):4822-39.
PMID: 7876255

Comment:
This protein is similar to a component of the phosphoenolpyruvate-
dependent sugar phosphotransferase system (PTS), a major carbohydrate
active-transport system. The IICD domains contain the sugar binding
site and the transmembrane channel; the IIA domain contains
the primary phosphorylation site (the donor is phospho-HPR); IIA
transfers its phosphoryl group to the IIB domain which finally
transfers it to the sugar.

Reaction: PROTEIN N-PHOSPHOHISTIDINE + SUGAR =
PROTEIN HISTIDINE + SUGAR PHOSPHATE.

Blast Summary:  PSI-Blast Search
There are many significant hits to phosphotransferase proteins with
PTS system, nitrogen regulatory IIA component being the most common.
Residues 24-179 are 24% similar to PTSN_KLEPN. However the most
similar protein is phosphotransferase system (PTS) fructose-specific
enzyme IIBC component of Bacillus subtilis, (Z99111). Residues 29-178
are 33% similar to the B. subtilis protein.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class:? G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 67-166 are 28% similar to PTFB_MYCGE, FRUCTOSE-SPECIFIC IIABC
COMPONENT of the pts system. Residues 74-137 are 37% similar to
PHOSPHOTRANSFERASE ENZYME II IIABC of HRSA_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0085, PTS system nitrogen
regulatory IIA component. Residues 31-176 are 27% similar to TP0085.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MWRFRRSEVERWVDTCLSCSHRQSHSDVLPIERILSTDRILHLEQSERRP
ALYELSDCLSTAPQIKNRSELAAEIVRREELMSTAIGCGIAVPHVRLSSV
TDLVMAVGISKKGIADFGPLDGQDVHLVFMIAAATNQHRYYLQTLSFFSS
KLKRPDLRTRLLQTNTALEAYTVLTEQSSL

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGGCGGTTTCGCAGGTCAGAAGTTGAGCGATGGGTTGACACTTGTCT
TTCCTGTTCTCACAGACAGAGCCATTCGGATGTTTTGCCCATTGAGCGGA
TCCTGTCCACCGATCGTATCCTGCATCTTGAACAGTCTGAGCGTCGTCCG
GCGCTCTATGAGCTTTCTGATTGCTTGAGCACTGCACCTCAGATTAAAAA
TCGTAGCGAGCTTGCGGCAGAAATAGTGCGGCGCGAGGAGCTCATGTCGA
CTGCAATTGGGTGTGGTATTGCAGTTCCTCATGTGCGCTTGTCTTCTGTA
ACTGATTTGGTTATGGCGGTAGGAATTTCAAAAAAAGGTATTGCTGATTT
CGGTCCTCTTGACGGACAAGACGTACATCTTGTTTTTATGATTGCCGCTG
CTACCAATCAGCACCGGTACTATTTGCAAACGCTTTCTTTTTTTAGTTCA
AAATTGAAAAGGCCCGATTTGCGGACGCGCCTCTTGCAGACTAACACCGC
GCTAGAAGCGTACACCGTGTTGACAGAGCAGTCTAGTTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy