Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR528 IGR526 IGR530 IGR531 IGR527 IGR525 IGR532 IGR529 TP0738 TP0740 TP0741 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 obg, - TP0742 TP0739 glt, - TP0735 TP0733 TP0731 TP0737 TP0738 TP0740 TP0741 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 obg, - TP0742 TP0739 glt, - TP0735 TP0733 TP0731 TP0737 Type: tandem, Name:  - 169 Type: tandem, Name:  - 170 Type: tandem, Name:  - 298 TP0738 TP0740 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 obg, - TP0742 TP0739 glt, - TP0735 TP0741 TP0733 TP0731 TP0737
* Calculated from Protein Sequence

Gene ID: TP0736

DNA Molecule Name:
1  

Genbank ID:
3323041

Gene Name:
hydG  

Definition:
possible hydrogenase gamma chain homolog (conserved hypothetical protein)

Gene Start:
802268

Gene Stop:
801429

Gene Length:
840

Molecular Weight*:
30419

pI*:
6.41

Net Charge*:
-3.30

EC:
1.12.2.1  

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Verhagen MF, O'Rourke TW, Menon AL, Adams MW.
Heterologous expression and properties of the gamma-subunit of the Fe-only hydrogenase from Thermotoga maritima.
Biochim Biophys Acta. 2001 Jun;1505(2-3):209-19.
PMID: 11334785

Leonhartsberger S, Huber A, Lottspeich F, Böck A.
The hydH/G Genes from Escherichia coli code for a zinc and lead responsive two-component regulatory system.
J Mol Biol. 2001 Mar;307(1):93-105.
PMID: 11243806

Chopra AK, Peterson JW, Prasad R.
Cloning and sequence analysis of hydrogenase regulatory genes (hydHG) from Salmonella typhimurium.
Biochim Biophys Acta. 1991 Dec;1129(1):115-8.
PMID: 1756170

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hypothetical proteins
and to hydrogenase gamma chain homologs. For example residues 1-265
are 25% similar to a hypothetical protein of Aquifex aeolicus,(AE000772).
Residues 64-251 are 31% similar to cytochrome-c3 hydrogenase, gamma chain
of Methanococcus jannaschii,(U67585).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0543
COG name: 2-Octaprenylphenol hydroxylase and related flavodoxin oxidoreductases
Functional Class:? H,C
The phylogenetic pattern of COG0543 is amtKYQV-EbRh-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 103-122 represent a significant (96%) hit to block PR00406D,
CYTOCHROME B5 REDUCTASE SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 3-249 are 30% similar to YLXD_BACCL, a hypothetical protein.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 99 to 200 (E-value = 4.4e-08) place TP0736 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

PDB Hit:
none

Gene Protein Sequence:
MFSILEKKQFSPQVFYLKVHAPDIAKNRAAGQFVLVQLDDEYAERIPLTI
ADAHADEGWIALVIQTVGATTMRLCEKEVGDSISVVLGPLGNPTLIENVG
TVACVAGGVGAAPLYPIAQAHKRAGNHVIVILGARNRDLIIFEEEMRALA
DELVIVTDDGSYGRKGLVTEPLRELCXRASCPQEVVAIGPPIMMKFCAET
TRPFGIRTVVSLNTIMIDGTGMCGGCRVNVGSEIKFVCVDGPEFDGHQVD
FESMMRRMRAFQAREAHDVHCCKMKHHAGR

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCAGCATTCTAGAAAAGAAACAATTTTCTCCGCAGGTGTTTTACTT
GAAGGTGCATGCACCTGATATTGCAAAAAATCGTGCTGCAGGACAGTTTG
TGCTTGTTCAACTTGATGACGAATACGCTGAGCGCATACCGCTAACGATT
GCGGACGCGCATGCGGATGAAGGGTGGATTGCGCTAGTGATCCAGACTGT
TGGCGCCACTACTATGAGGCTGTGCGAAAAGGAAGTGGGCGATTCCATCT
CTGTAGTTCTCGGTCCGTTGGGAAATCCAACTCTCATTGAAAATGTAGGA
ACTGTCGCCTGCGTTGCAGGGGGTGTTGGGGCAGCTCCGCTGTATCCTAT
TGCCCAGGCGCATAAAAGGGCTGGAAATCACGTCATTGTAATCCTTGGGG
CGCGCAATCGGGATTTAATTATTTTTGAAGAGGAGATGCGCGCGCTTGCA
GACGAGCTGGTCATTGTCACAGACGACGGCTCATATGGACGCAAGGGCTT
AGTGACTGAGCCCCTGCGTGAGCTGTGCRAGCGCGCGTCCTGTCCACAGG
AGGTGGTTGCTATCGGTCCGCCGATTATGATGAAGTTTTGTGCGGAAACG
ACGCGCCCCTTTGGGATCCGCACGGTCGTATCTTTGAACACCATTATGAT
TGACGGCACTGGCATGTGCGGTGGCTGTCGGGTGAATGTAGGTTCTGAGA
TAAAATTTGTTTGCGTGGACGGACCTGAATTTGACGGGCATCAAGTTGAT
TTTGAGAGCATGATGCGGAGAATGAGGGCATTTCAGGCAAGGGAAGCGCA
TGATGTCCACTGCTGTAAGATGAAGCACCACGCGGGGAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy