Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR528 IGR524 IGR526 IGR530 IGR527 IGR525 IGR529 TP0738 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 TP0739 glt, - TP0735 tap1, - TP0729 TP0733 TP0731 pss,pgsA, - TP0730 TP0737 TP0738 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 TP0739 glt, - TP0735 tap1, - TP0729 TP0733 TP0731 pss,pgsA, - TP0730 TP0737 Type: tandem, Name:  - 168 Type: tandem, Name:  - 169 deoD, - TP0734 hydG, - TP0736 folD, - TP0732 TP0739 glt, - TP0735 tap1, - TP0729 TP0738 TP0733 TP0731 pss,pgsA, - TP0730 TP0737
* Calculated from Protein Sequence

Gene ID: TP0734

DNA Molecule Name:
1  

Genbank ID:
3323039

Gene Name:
deoD  

Definition:
purine nucleoside phosphorylase

Gene Start:
799785

Gene Stop:
799087

Gene Length:
699

Molecular Weight*:
25303

pI*:
6.37

Net Charge*:
-1.89

EC:
2.4.2.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Primary Evidence:
Mushegian AR, Koonin EV. 1994. Unexpected sequence similarity between nucleosidases and phosphoribosyltransferases of different specificity. Protein Sci Jul;3(7):1081-8. Medline: 95004041

Secondary Evidence:
Varcamonti M, Graziano MR, Pezzopane R, Naclerio G, Arsenijevic S, De Felice M.
Impaired temperature stress response of a Streptococcus thermophilus deoD mutant.
Appl Environ Microbiol. 2003 Feb;69(2):1287-9.
PMID: 12571059

Basso LA, Santos DS, Shi W, Furneaux RH, Tyler PC, Schramm VL, Blanchard JS.
Purine nucleoside phosphorylase from Mycobacterium tuberculosis. Analysis of inhibition by a transition-state analogue and dissection by parts.
Biochemistry. 2001 Jul;40(28):8196-203.
PMID: 11444965

Sorscher EJ, Peng S, Bebok Z, Allan PW, Bennett LL, Parker WB.
Tumor cell bystander killing in colonic carcinoma utilizing the Escherichia coli DeoD gene to generate toxic purines.
Gene Ther. 1994 Jul;1(4):233-8.
PMID: 7584086

Comment:
This protein is involved in cleavage of guanosine or inosine to
respective bases and sugar-1-phosphate molecules.

Reaction:
PURINE NUCLEOSIDE + ORTHOPHOSPHATE = PURINE + ALPHA-D-RIBOSE 1-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to purine nucleoside
phosphorylases. For example residues 1-233 are 57% similar to
purine nucleoside phosphorylase of Bacillus stearothermophilus,(D87960).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0813
COG name: Purine-nucleoside (and uridine) phosphorylase
Functional Class:? F
The phylogenetic pattern of COG0813 is --------Eb-HUJgp-L---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 16-26, 57-69, 81-94, 150-160, and 173-201 represent
significant (99%) hits to blocks BL01232A,B,C,D,E, Purine and other
phosphorylases family 1 proteins.


ProDom Summary:  Protein Domain Search
Residues 45-109 are 63% similar to purine nucleoside phosphorylase of
DEOD_STRTR. Residues 16-43, 111-160, and 171-205 also support this
match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1027, uridine phosphorylase.
Residues 4-231 are 28% similar to TP1027.

Pfam Summary:  Pfam Search
Residues 14 to 231 (E-value = 4.8e-79) place TP0734 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

PDB Hit:
gi|1633413|pdb|1ECP|A Escherichia coli

Gene Protein Sequence:
MSIHLGAKGEDIAPRVLLPGDPLRARFVAERFFHNAYCYNEVRGMLGFTG
TYKGVRVSVQGTGMGLPSHSIYVTELFQDYGVQKAIRVGTAGGLQEEVAL
KSVVCALGAATDSAINARRFSGMHFAPTASWSLLRTAVSVADEMGTGVQV
GNVISSDVFYDESGSWRLWARYGVLAVEMETAELYTLAAKFRREALSILT
ISDHLVTGAVTSAQERERSFTQMIEIALEAIIQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTATTCACCTTGGAGCAAAGGGAGAGGATATTGCGCCGCGCGTGCT
GTTGCCCGGTGACCCGCTGCGTGCGCGTTTTGTGGCGGAGCGTTTTTTTC
ACAATGCGTATTGCTACAATGAGGTGCGTGGCATGCTCGGGTTTACGGGA
ACCTACAAGGGGGTGCGCGTGTCGGTGCAGGGGACAGGTATGGGGCTGCC
GTCGCACTCAATTTACGTAACGGAGCTGTTTCAAGATTATGGGGTGCAAA
AGGCAATCCGCGTGGGGACTGCCGGTGGATTGCAGGAGGAAGTGGCGCTC
AAATCGGTGGTGTGTGCGCTGGGTGCGGCAACGGATTCTGCAATAAACGC
GCGCAGGTTTAGCGGCATGCACTTTGCGCCCACGGCAAGCTGGTCGCTCC
TGCGCACGGCAGTGTCGGTTGCTGATGAAATGGGCACGGGGGTGCAGGTG
GGGAATGTAATTTCCTCTGACGTCTTTTACGATGAATCAGGAAGCTGGCG
CCTGTGGGCCCGGTATGGGGTGTTAGCGGTGGAAATGGAAACGGCGGAGC
TGTACACGCTTGCTGCAAAGTTCAGACGCGAGGCGCTGAGCATTCTGACT
ATCTCTGACCACCTGGTAACCGGCGCGGTAACTAGCGCGCAGGAGCGGGA
GCGCTCCTTTACCCAAATGATAGAAATTGCGCTTGAAGCCATTATCCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy